BLASTX nr result
ID: Cocculus23_contig00036589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00036589 (332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME47782.1| hypothetical protein DOTSEDRAFT_69650 [Dothistrom... 59 9e-07 gb|EME85934.1| hypothetical protein MYCFIDRAFT_210365 [Pseudocer... 56 6e-06 >gb|EME47782.1| hypothetical protein DOTSEDRAFT_69650 [Dothistroma septosporum NZE10] Length = 284 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/55 (52%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +1 Query: 4 WRAIKSLHHSRTSSLADSQLTLQSPLPIPQGPTNKLVSHVGSMARSE-GMVWSTF 165 WR I+ LHHSRT+S+A+S + + +PIP + + +GSMARSE GMVWSTF Sbjct: 230 WRVIRKLHHSRTNSIAESSSSGGTAMPIPNLRQKRDDARIGSMARSEGGMVWSTF 284 >gb|EME85934.1| hypothetical protein MYCFIDRAFT_210365 [Pseudocercospora fijiensis CIRAD86] Length = 282 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/57 (52%), Positives = 39/57 (68%), Gaps = 2/57 (3%) Frame = +1 Query: 1 EWRAIKSLHHSRTSSLADSQLTLQ-SPLPIPQGPTNKLVSHVGSMARSE-GMVWSTF 165 +W+ IK LHHSR SS+ADS + + +PIP+ + +GSMARSE GMVWSTF Sbjct: 226 DWKIIKKLHHSRASSIADSSGSSHGTAMPIPRTQQPQEDMRIGSMARSEGGMVWSTF 282