BLASTX nr result
ID: Cocculus23_contig00036284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00036284 (435 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007226707.1| hypothetical protein PRUPE_ppa020120mg [Prun... 46 7e-08 >ref|XP_007226707.1| hypothetical protein PRUPE_ppa020120mg [Prunus persica] gi|462423643|gb|EMJ27906.1| hypothetical protein PRUPE_ppa020120mg [Prunus persica] Length = 1011 Score = 45.8 bits (107), Expect(2) = 7e-08 Identities = 22/43 (51%), Positives = 28/43 (65%) Frame = +1 Query: 292 KKEGGLPRPVHQM*EFRRVVDECGLIDMGYVGSRFT*TNKRKG 420 +KEGGL RPV QM FR + +C L DMG+ G+ FT + R G Sbjct: 118 EKEGGLIRPVRQMLAFRDAISDCHLDDMGFEGATFTWFSTRNG 160 Score = 36.2 bits (82), Expect(2) = 7e-08 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +3 Query: 213 LLRKLIEDSS*AWVVLGDFNEIMEADEKRRGFTK 314 LLR L +S WV +GDFNE++ A+EK G + Sbjct: 92 LLRDLASESRLPWVCMGDFNELLYANEKEGGLIR 125