BLASTX nr result
ID: Cocculus23_contig00036154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00036154 (254 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB75198.1| hypothetical protein L484_025978 [Morus notabilis] 55 8e-06 >gb|EXB75198.1| hypothetical protein L484_025978 [Morus notabilis] Length = 1613 Score = 55.5 bits (132), Expect = 8e-06 Identities = 37/104 (35%), Positives = 55/104 (52%), Gaps = 20/104 (19%) Frame = +3 Query: 3 KFAEEQSKKAISEKSHSDKLSQELEEQKRK-------------NGVLEEEVQRTMSAMKK 143 K AE KK + + H+ LS++LEE K + + LEE +R +K Sbjct: 458 KLAEANMKKVVEGRIHAQSLSRQLEENKTRIEEVCESKLVLELSAKLEEANRRFQLEKEK 517 Query: 144 ANREKEHADTKMKKV-------EEERQKAISEKNCSYQLSQQLQ 254 A+REKE AD +M KV E R+K++ EK+ + QLS+QL+ Sbjct: 518 ASREKERADAEMLKVLKQNEVAEVNRKKSLEEKSRADQLSRQLE 561