BLASTX nr result
ID: Cocculus23_contig00035966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00035966 (468 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME80493.1| hypothetical protein MYCFIDRAFT_50007 [Pseudocerc... 63 5e-08 gb|EMC91057.1| hypothetical protein BAUCODRAFT_39181 [Baudoinia ... 60 4e-07 gb|EQB55756.1| major facilitator superfamily transporter [Collet... 59 5e-07 ref|XP_007276155.1| MFS multidrug transporter [Colletotrichum gl... 58 2e-06 ref|XP_387740.1| hypothetical protein FG07564.1 [Fusarium gramin... 57 2e-06 gb|EKJ69231.1| hypothetical protein FPSE_10569 [Fusarium pseudog... 57 2e-06 gb|EHK44927.1| hypothetical protein TRIATDRAFT_38398 [Trichoderm... 57 2e-06 gb|EGY17015.1| multidrug transporter [Verticillium dahliae VdLs.17] 57 3e-06 ref|XP_003001469.1| multidrug transporter [Verticillium alfalfae... 57 3e-06 gb|EJP65052.1| major facilitator superfamily transporter [Beauve... 57 3e-06 gb|EMF09835.1| MFS general substrate transporter [Sphaerulina mu... 56 5e-06 gb|EME39453.1| hypothetical protein DOTSEDRAFT_38641 [Dothistrom... 56 5e-06 gb|EFY99470.1| MFS multidrug transporter, putative [Metarhizium ... 56 6e-06 gb|EFY86599.1| MFS multidrug transporter, putative [Metarhizium ... 56 6e-06 >gb|EME80493.1| hypothetical protein MYCFIDRAFT_50007 [Pseudocercospora fijiensis CIRAD86] Length = 626 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 465 RFFGESRVTPRGTPRGTPSASRANSLANVHNKRT 364 RFFGESR+TPRGTPRGTPSASR NS+AN+H +T Sbjct: 587 RFFGESRITPRGTPRGTPSASRVNSVANLHKAKT 620 >gb|EMC91057.1| hypothetical protein BAUCODRAFT_39181 [Baudoinia compniacensis UAMH 10762] Length = 628 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -1 Query: 465 RFFGESRVTPRGTPRGTPSASRANSLANV 379 RFFGESRVTPRGTPRGTPSASRANS++NV Sbjct: 590 RFFGESRVTPRGTPRGTPSASRANSISNV 618 >gb|EQB55756.1| major facilitator superfamily transporter [Colletotrichum gloeosporioides Cg-14] Length = 625 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 465 RFFGESRVTPRGTPRGTPSASRANSLANVHNKR 367 RFFGESRVTPRGTPRGTPSASRANS AN ++R Sbjct: 592 RFFGESRVTPRGTPRGTPSASRANSRANSPSRR 624 >ref|XP_007276155.1| MFS multidrug transporter [Colletotrichum gloeosporioides Nara gc5] gi|429859946|gb|ELA34701.1| MFS multidrug transporter [Colletotrichum gloeosporioides Nara gc5] Length = 629 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -1 Query: 465 RFFGESRVTPRGTPRGTPSASRANSLAN 382 RFFGESRVTPRGTPRGTPSASRANS AN Sbjct: 592 RFFGESRVTPRGTPRGTPSASRANSRAN 619 >ref|XP_387740.1| hypothetical protein FG07564.1 [Fusarium graminearum PH-1] gi|558863754|gb|ESU13837.1| hypothetical protein FGSG_07564 [Fusarium graminearum PH-1] gi|596542652|gb|EYB23084.1| hypothetical protein FG05_07564 [Fusarium graminearum] Length = 620 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 465 RFFGESRVTPRGTPRGTPSASRANSLANVH 376 RFFGESRVTPRGTPRGTPSASR S AN+H Sbjct: 588 RFFGESRVTPRGTPRGTPSASRRASAANIH 617 >gb|EKJ69231.1| hypothetical protein FPSE_10569 [Fusarium pseudograminearum CS3096] Length = 620 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 465 RFFGESRVTPRGTPRGTPSASRANSLANVH 376 RFFGESRVTPRGTPRGTPSASR S AN+H Sbjct: 588 RFFGESRVTPRGTPRGTPSASRRASAANIH 617 >gb|EHK44927.1| hypothetical protein TRIATDRAFT_38398 [Trichoderma atroviride IMI 206040] Length = 618 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 465 RFFGESRVTPRGTPRGTPSASRANSLANVHNK 370 RFFGESRVTPRGTPRGTP+ASR SLANV K Sbjct: 587 RFFGESRVTPRGTPRGTPAASRRQSLANVARK 618 >gb|EGY17015.1| multidrug transporter [Verticillium dahliae VdLs.17] Length = 620 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 465 RFFGESRVTPRGTPRGTPSASRANSLA 385 RFFGESRVTPRGTPRGTPSASRANS+A Sbjct: 590 RFFGESRVTPRGTPRGTPSASRANSIA 616 >ref|XP_003001469.1| multidrug transporter [Verticillium alfalfae VaMs.102] gi|261359976|gb|EEY22404.1| multidrug transporter [Verticillium alfalfae VaMs.102] Length = 572 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 465 RFFGESRVTPRGTPRGTPSASRANSLA 385 RFFGESRVTPRGTPRGTPSASRANS+A Sbjct: 542 RFFGESRVTPRGTPRGTPSASRANSIA 568 >gb|EJP65052.1| major facilitator superfamily transporter [Beauveria bassiana ARSEF 2860] Length = 627 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 465 RFFGESRVTPRGTPRGTPSASRANSLANVHNK 370 RFFGESRVTPR TPRGTPSASR SLAN+H K Sbjct: 596 RFFGESRVTPRQTPRGTPSASRRPSLANLHAK 627 >gb|EMF09835.1| MFS general substrate transporter [Sphaerulina musiva SO2202] Length = 610 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 468 QRFFGESRVTPRGTPRGTPSASRANSLANV 379 QRFFGE+RVTPR TPRGTPSASRANS+A++ Sbjct: 577 QRFFGENRVTPRQTPRGTPSASRANSIAHI 606 >gb|EME39453.1| hypothetical protein DOTSEDRAFT_38641 [Dothistroma septosporum NZE10] Length = 616 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 468 QRFFGESRVTPRGTPRGTPSASRANSL 388 QRFFGESRVTPRGTPRGTP ASRANSL Sbjct: 577 QRFFGESRVTPRGTPRGTPHASRANSL 603 >gb|EFY99470.1| MFS multidrug transporter, putative [Metarhizium anisopliae ARSEF 23] gi|594721601|gb|EXV04488.1| MFS transporter [Metarhizium robertsii] Length = 621 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 465 RFFGESRVTPRGTPRGTPSASRANSLANVHNKR 367 RFFGESRVTPRGTPRGTPSASR S+AN+ K+ Sbjct: 589 RFFGESRVTPRGTPRGTPSASRRPSMANLAAKK 621 >gb|EFY86599.1| MFS multidrug transporter, putative [Metarhizium acridum CQMa 102] Length = 619 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 465 RFFGESRVTPRGTPRGTPSASRANSLANVHNKR 367 RFFGESRVTPRGTPRGTPSASR S+AN+ K+ Sbjct: 587 RFFGESRVTPRGTPRGTPSASRRPSMANLAAKK 619