BLASTX nr result
ID: Cocculus23_contig00035782
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00035782 (217 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004245911.1| PREDICTED: pentatricopeptide repeat-containi... 81 1e-13 ref|XP_007014264.1| Pentatricopeptide repeat-containing protein,... 81 2e-13 ref|XP_006352878.1| PREDICTED: pentatricopeptide repeat-containi... 79 6e-13 ref|XP_006352876.1| PREDICTED: pentatricopeptide repeat-containi... 79 6e-13 ref|XP_006487095.1| PREDICTED: pentatricopeptide repeat-containi... 77 2e-12 ref|XP_006423034.1| hypothetical protein CICLE_v10030202mg [Citr... 77 3e-12 ref|XP_006836883.1| hypothetical protein AMTR_s00099p00108770 [A... 76 4e-12 ref|XP_002510967.1| pentatricopeptide repeat-containing protein,... 75 1e-11 gb|EPS58828.1| hypothetical protein M569_15985, partial [Genlise... 73 5e-11 ref|XP_003635427.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 emb|CBI38482.3| unnamed protein product [Vitis vinifera] 72 6e-11 emb|CAN67256.1| hypothetical protein VITISV_039434 [Vitis vinifera] 72 6e-11 ref|XP_004508428.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 ref|XP_006279545.1| hypothetical protein CARUB_v10028516mg [Caps... 70 3e-10 ref|XP_004301520.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 ref|NP_201237.1| pentatricopeptide repeat-containing protein [Ar... 69 7e-10 ref|XP_007141459.1| hypothetical protein PHAVU_008G197500g [Phas... 68 1e-09 ref|XP_003617308.1| Auxin response factor [Medicago truncatula] ... 68 1e-09 ref|XP_002866609.1| pentatricopeptide repeat-containing protein ... 67 3e-09 ref|XP_003518493.2| PREDICTED: pentatricopeptide repeat-containi... 63 5e-08 >ref|XP_004245911.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Solanum lycopersicum] Length = 720 Score = 81.3 bits (199), Expect = 1e-13 Identities = 34/54 (62%), Positives = 47/54 (87%) Frame = +1 Query: 37 SECENEWEKLLRPFDLEELQKSLNHITPHQLYQILMLPLDLPTLVDIFDWAGTQ 198 SE ENEWE+LL+PFD ++LQ+SLN ITP+QL ++L LPLD+PT +++F WAG+Q Sbjct: 45 SESENEWERLLKPFDFKQLQRSLNKITPYQLNKLLALPLDVPTSMELFQWAGSQ 98 >ref|XP_007014264.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|590581139|ref|XP_007014265.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|590581142|ref|XP_007014266.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508784627|gb|EOY31883.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508784628|gb|EOY31884.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508784629|gb|EOY31885.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 716 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/55 (63%), Positives = 47/55 (85%) Frame = +1 Query: 34 RSECENEWEKLLRPFDLEELQKSLNHITPHQLYQILMLPLDLPTLVDIFDWAGTQ 198 +SE ENEWE+LL+PFDL+EL+KS N ITP+QL ++L LPLD+PT + +F WAG+Q Sbjct: 37 QSESENEWERLLKPFDLDELRKSFNKITPYQLCKLLELPLDVPTSLKLFHWAGSQ 91 >ref|XP_006352878.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X3 [Solanum tuberosum] Length = 612 Score = 79.0 bits (193), Expect = 6e-13 Identities = 33/54 (61%), Positives = 46/54 (85%) Frame = +1 Query: 37 SECENEWEKLLRPFDLEELQKSLNHITPHQLYQILMLPLDLPTLVDIFDWAGTQ 198 SE ENEWE+LL+PFD ++LQ+SLN ITP+QL ++L LPLD+PT +++F WA +Q Sbjct: 45 SESENEWERLLKPFDFKQLQRSLNKITPYQLNKLLALPLDVPTSMELFQWASSQ 98 >ref|XP_006352876.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565372595|ref|XP_006352877.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X2 [Solanum tuberosum] Length = 720 Score = 79.0 bits (193), Expect = 6e-13 Identities = 33/54 (61%), Positives = 46/54 (85%) Frame = +1 Query: 37 SECENEWEKLLRPFDLEELQKSLNHITPHQLYQILMLPLDLPTLVDIFDWAGTQ 198 SE ENEWE+LL+PFD ++LQ+SLN ITP+QL ++L LPLD+PT +++F WA +Q Sbjct: 45 SESENEWERLLKPFDFKQLQRSLNKITPYQLNKLLALPLDVPTSMELFQWASSQ 98 >ref|XP_006487095.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Citrus sinensis] gi|568867543|ref|XP_006487096.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X2 [Citrus sinensis] Length = 728 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/54 (64%), Positives = 45/54 (83%) Frame = +1 Query: 37 SECENEWEKLLRPFDLEELQKSLNHITPHQLYQILMLPLDLPTLVDIFDWAGTQ 198 SE ENEWE+LL+PFDL EL+KSL+ ITP QL ++L LPLD+ T ++IF WAG+Q Sbjct: 54 SESENEWERLLKPFDLNELRKSLHKITPFQLCKLLRLPLDVDTSMEIFTWAGSQ 107 >ref|XP_006423034.1| hypothetical protein CICLE_v10030202mg [Citrus clementina] gi|557524968|gb|ESR36274.1| hypothetical protein CICLE_v10030202mg [Citrus clementina] Length = 728 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/54 (62%), Positives = 45/54 (83%) Frame = +1 Query: 37 SECENEWEKLLRPFDLEELQKSLNHITPHQLYQILMLPLDLPTLVDIFDWAGTQ 198 SE ENEWE+LL+PFDL EL+KSL+ ITP QL ++L LPLD+ T +++F WAG+Q Sbjct: 54 SESENEWERLLKPFDLNELRKSLHKITPFQLCKLLRLPLDVDTSMELFTWAGSQ 107 >ref|XP_006836883.1| hypothetical protein AMTR_s00099p00108770 [Amborella trichopoda] gi|548839447|gb|ERM99736.1| hypothetical protein AMTR_s00099p00108770 [Amborella trichopoda] Length = 712 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/66 (54%), Positives = 48/66 (72%), Gaps = 3/66 (4%) Frame = +1 Query: 10 CKSSLDTIR---SECENEWEKLLRPFDLEELQKSLNHITPHQLYQILMLPLDLPTLVDIF 180 C + L+ IR S ENEWEK+L+PF LEEL+KS N ITP +L ++L LPLDL ++IF Sbjct: 29 CPAKLERIRDHRSSSENEWEKILKPFGLEELRKSFNRITPQRLCKLLFLPLDLSLSLEIF 88 Query: 181 DWAGTQ 198 +WA +Q Sbjct: 89 EWAASQ 94 >ref|XP_002510967.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550082|gb|EEF51569.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 774 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/61 (57%), Positives = 46/61 (75%) Frame = +1 Query: 16 SSLDTIRSECENEWEKLLRPFDLEELQKSLNHITPHQLYQILMLPLDLPTLVDIFDWAGT 195 S L SE E EWE+LL+PFDL+EL++S N ITP QL ++L+LPLD+ T + IF WAG+ Sbjct: 35 SKLKDDDSENETEWERLLKPFDLKELRRSFNQITPFQLCKLLLLPLDVSTSMAIFQWAGS 94 Query: 196 Q 198 Q Sbjct: 95 Q 95 >gb|EPS58828.1| hypothetical protein M569_15985, partial [Genlisea aurea] Length = 542 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/50 (64%), Positives = 41/50 (82%) Frame = +1 Query: 49 NEWEKLLRPFDLEELQKSLNHITPHQLYQILMLPLDLPTLVDIFDWAGTQ 198 NEWEKLL+PFD EEL+K+LN ITP QL +L LPLD+PT +++F +AG Q Sbjct: 1 NEWEKLLKPFDFEELRKTLNKITPSQLNMLLQLPLDVPTSMELFHFAGAQ 50 >ref|XP_003635427.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Vitis vinifera] Length = 740 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/49 (63%), Positives = 41/49 (83%) Frame = +1 Query: 52 EWEKLLRPFDLEELQKSLNHITPHQLYQILMLPLDLPTLVDIFDWAGTQ 198 EWE+LL+PFDL EL+ SL ITP+QL ++L LPLD+PT +++F WAGTQ Sbjct: 74 EWERLLKPFDLPELRTSLTRITPYQLCKLLELPLDVPTSMELFQWAGTQ 122 >emb|CBI38482.3| unnamed protein product [Vitis vinifera] Length = 368 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/49 (63%), Positives = 41/49 (83%) Frame = +1 Query: 52 EWEKLLRPFDLEELQKSLNHITPHQLYQILMLPLDLPTLVDIFDWAGTQ 198 EWE+LL+PFDL EL+ SL ITP+QL ++L LPLD+PT +++F WAGTQ Sbjct: 56 EWERLLKPFDLPELRTSLTRITPYQLCKLLELPLDVPTSMELFQWAGTQ 104 >emb|CAN67256.1| hypothetical protein VITISV_039434 [Vitis vinifera] Length = 722 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/49 (63%), Positives = 41/49 (83%) Frame = +1 Query: 52 EWEKLLRPFDLEELQKSLNHITPHQLYQILMLPLDLPTLVDIFDWAGTQ 198 EWE+LL+PFDL EL+ SL ITP+QL ++L LPLD+PT +++F WAGTQ Sbjct: 56 EWERLLKPFDLPELRTSLTRITPYQLCKLLELPLDVPTSMELFQWAGTQ 104 >ref|XP_004508428.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Cicer arietinum] gi|502151414|ref|XP_004508429.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X2 [Cicer arietinum] gi|502151416|ref|XP_004508430.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X3 [Cicer arietinum] gi|502151418|ref|XP_004508431.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X4 [Cicer arietinum] Length = 712 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/54 (55%), Positives = 45/54 (83%) Frame = +1 Query: 37 SECENEWEKLLRPFDLEELQKSLNHITPHQLYQILMLPLDLPTLVDIFDWAGTQ 198 +E + EWE++L+PFDL+ LQ+SLN ITP QL ++L LPLD+PT +++F+ AG+Q Sbjct: 42 TESDTEWERVLKPFDLKHLQRSLNPITPSQLCKLLELPLDIPTSMELFEKAGSQ 95 >ref|XP_006279545.1| hypothetical protein CARUB_v10028516mg [Capsella rubella] gi|482548249|gb|EOA12443.1| hypothetical protein CARUB_v10028516mg [Capsella rubella] Length = 728 Score = 70.1 bits (170), Expect = 3e-10 Identities = 28/50 (56%), Positives = 41/50 (82%) Frame = +1 Query: 49 NEWEKLLRPFDLEELQKSLNHITPHQLYQILMLPLDLPTLVDIFDWAGTQ 198 NEWEKLL+PFD++ L+ S++ ITP QLY++L LPLD+ T +++F W G+Q Sbjct: 53 NEWEKLLKPFDIDSLRNSIHKITPFQLYKLLELPLDVSTSMELFSWTGSQ 102 >ref|XP_004301520.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 711 Score = 70.1 bits (170), Expect = 3e-10 Identities = 36/66 (54%), Positives = 46/66 (69%) Frame = +1 Query: 1 SGGCKSSLDTIRSECENEWEKLLRPFDLEELQKSLNHITPHQLYQILMLPLDLPTLVDIF 180 S G D SE ENEWE+LL+PFDL EL+KSL ITP QL ++L LPLD+PT +++F Sbjct: 25 SAGYVKGSDDSGSE-ENEWERLLKPFDLNELRKSLIQITPIQLSKLLELPLDVPTSLEVF 83 Query: 181 DWAGTQ 198 + G Q Sbjct: 84 EMVGAQ 89 >ref|NP_201237.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75171655|sp|Q9FMF6.1|PP444_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g64320, mitochondrial; Flags: Precursor gi|9759408|dbj|BAB09863.1| unnamed protein product [Arabidopsis thaliana] gi|332010486|gb|AED97869.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 730 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/64 (48%), Positives = 46/64 (71%) Frame = +1 Query: 7 GCKSSLDTIRSECENEWEKLLRPFDLEELQKSLNHITPHQLYQILMLPLDLPTLVDIFDW 186 G SS + ++ NEWEKLL+PFDL+ L+ S + ITP QLY++L LPL++ T +++F W Sbjct: 41 GGGSSPEIGGTDSANEWEKLLKPFDLDSLRNSFHKITPFQLYKLLELPLNVSTSMELFSW 100 Query: 187 AGTQ 198 G+Q Sbjct: 101 TGSQ 104 >ref|XP_007141459.1| hypothetical protein PHAVU_008G197500g [Phaseolus vulgaris] gi|561014592|gb|ESW13453.1| hypothetical protein PHAVU_008G197500g [Phaseolus vulgaris] Length = 721 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/54 (53%), Positives = 44/54 (81%) Frame = +1 Query: 37 SECENEWEKLLRPFDLEELQKSLNHITPHQLYQILMLPLDLPTLVDIFDWAGTQ 198 S+ E EWE+LL+PFDL++L++SL I+P QL ++L+LPLD+PT +++F AG Q Sbjct: 43 SDSETEWERLLKPFDLKQLRRSLTPISPFQLCKLLVLPLDIPTSMELFQRAGAQ 96 >ref|XP_003617308.1| Auxin response factor [Medicago truncatula] gi|355518643|gb|AET00267.1| Auxin response factor [Medicago truncatula] Length = 948 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/51 (58%), Positives = 41/51 (80%) Frame = +1 Query: 46 ENEWEKLLRPFDLEELQKSLNHITPHQLYQILMLPLDLPTLVDIFDWAGTQ 198 + EWE LL+P+DL+ LQ+SLN ITP QL ++L LPLD+PT +D+F+ AG Q Sbjct: 37 DTEWENLLKPYDLKHLQRSLNPITPSQLCKLLELPLDVPTSMDLFEKAGLQ 87 >ref|XP_002866609.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297312444|gb|EFH42868.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 724 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/53 (52%), Positives = 40/53 (75%) Frame = +1 Query: 40 ECENEWEKLLRPFDLEELQKSLNHITPHQLYQILMLPLDLPTLVDIFDWAGTQ 198 + NEWEKLL+PFDL+ L+ S + ITP QL ++L LPLD+ T +++F W G+Q Sbjct: 46 DSSNEWEKLLKPFDLDSLRNSFHKITPFQLCKLLELPLDVSTSMELFSWTGSQ 98 >ref|XP_003518493.2| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Glycine max] Length = 739 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/63 (49%), Positives = 47/63 (74%), Gaps = 2/63 (3%) Frame = +1 Query: 16 SSLDTIRSECENEWEKLLRPFDLEELQKSLN--HITPHQLYQILMLPLDLPTLVDIFDWA 189 SS + S+ E EWE+LL+PFDL++L++SL+ I+P QL ++L LPLD+PT +++F A Sbjct: 44 SSSSSSSSDNETEWERLLKPFDLKQLRRSLSLTPISPFQLCKLLELPLDIPTSMELFQRA 103 Query: 190 GTQ 198 G Q Sbjct: 104 GAQ 106