BLASTX nr result
ID: Cocculus23_contig00035603
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00035603 (332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF10270.1| hypothetical protein SEPMUDRAFT_151254 [Sphaeruli... 61 2e-07 >gb|EMF10270.1| hypothetical protein SEPMUDRAFT_151254 [Sphaerulina musiva SO2202] Length = 585 Score = 60.8 bits (146), Expect = 2e-07 Identities = 36/98 (36%), Positives = 47/98 (47%), Gaps = 2/98 (2%) Frame = +2 Query: 35 MGDLGDREPKGSQVLPDAHETKQQTHHQENVPFHAQLEHFSASHQQGGPNYVQYGQQHAY 214 M DL + + V P H + Q H Q + PF +Q E+ S Q YGQ + Sbjct: 1 MADLMPSRSQETDVSPSYHGSVHQGHQQSSAPFQSQFEYLSQRQQHASHTPPHYGQTQPF 60 Query: 215 DMS-SMAGALP-SGSPMNQSSPYGPGDAKQMMHSPNPY 322 DMS ++AGALP + P YG D Q M SP+PY Sbjct: 61 DMSAALAGALPHTIQPGLDQRSYGSPDPSQAMTSPDPY 98