BLASTX nr result
ID: Cocculus23_contig00035528
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00035528 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007014683.1| TBP-associated factor 7 isoform 5 [Theobroma... 60 2e-07 ref|XP_007014679.1| TBP-associated factor 7 isoform 1 [Theobroma... 60 2e-07 ref|XP_004295000.1| PREDICTED: transcription initiation factor T... 58 2e-06 ref|XP_006488909.1| PREDICTED: transcription initiation factor T... 57 3e-06 ref|XP_002285704.2| PREDICTED: transcription initiation factor T... 57 3e-06 emb|CBI16511.3| unnamed protein product [Vitis vinifera] 57 3e-06 >ref|XP_007014683.1| TBP-associated factor 7 isoform 5 [Theobroma cacao] gi|508785046|gb|EOY32302.1| TBP-associated factor 7 isoform 5 [Theobroma cacao] Length = 210 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 94 MEEQFILRLPPSIAERVDRLLSENASSSEDK 2 MEEQFILR+PPSIAER+DRLLSENASSSEDK Sbjct: 1 MEEQFILRVPPSIAERIDRLLSENASSSEDK 31 >ref|XP_007014679.1| TBP-associated factor 7 isoform 1 [Theobroma cacao] gi|590582645|ref|XP_007014680.1| TBP-associated factor 7 isoform 1 [Theobroma cacao] gi|590582648|ref|XP_007014681.1| TBP-associated factor 7 isoform 1 [Theobroma cacao] gi|590582652|ref|XP_007014682.1| TBP-associated factor 7 isoform 1 [Theobroma cacao] gi|508785042|gb|EOY32298.1| TBP-associated factor 7 isoform 1 [Theobroma cacao] gi|508785043|gb|EOY32299.1| TBP-associated factor 7 isoform 1 [Theobroma cacao] gi|508785044|gb|EOY32300.1| TBP-associated factor 7 isoform 1 [Theobroma cacao] gi|508785045|gb|EOY32301.1| TBP-associated factor 7 isoform 1 [Theobroma cacao] Length = 200 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 94 MEEQFILRLPPSIAERVDRLLSENASSSEDK 2 MEEQFILR+PPSIAER+DRLLSENASSSEDK Sbjct: 1 MEEQFILRVPPSIAERIDRLLSENASSSEDK 31 >ref|XP_004295000.1| PREDICTED: transcription initiation factor TFIID subunit 7-like [Fragaria vesca subsp. vesca] Length = 204 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -2 Query: 94 MEEQFILRLPPSIAERVDRLLSENASSSEDK 2 MEEQF+LR+PPS+AER+DRLLSENASSS+DK Sbjct: 1 MEEQFVLRVPPSVAERLDRLLSENASSSDDK 31 >ref|XP_006488909.1| PREDICTED: transcription initiation factor TFIID subunit 7-like [Citrus sinensis] Length = 219 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 94 MEEQFILRLPPSIAERVDRLLSENASSSEDK 2 MEEQFILR+PPS+AER+DRLLSEN SS EDK Sbjct: 19 MEEQFILRVPPSVAERIDRLLSENESSEEDK 49 >ref|XP_002285704.2| PREDICTED: transcription initiation factor TFIID subunit 7-like [Vitis vinifera] Length = 205 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -2 Query: 94 MEEQFILRLPPSIAERVDRLLSENASSSEDK 2 MEEQFILR+PPSIAER++RLL+EN+SSSEDK Sbjct: 10 MEEQFILRVPPSIAERIERLLNENSSSSEDK 40 >emb|CBI16511.3| unnamed protein product [Vitis vinifera] Length = 148 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -2 Query: 94 MEEQFILRLPPSIAERVDRLLSENASSSEDK 2 MEEQFILR+PPSIAER++RLL+EN+SSSEDK Sbjct: 1 MEEQFILRVPPSIAERIERLLNENSSSSEDK 31