BLASTX nr result
ID: Cocculus23_contig00035510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00035510 (509 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN73354.1| hypothetical protein VITISV_016753 [Vitis vinifera] 56 6e-06 emb|CAN69913.1| hypothetical protein VITISV_042568 [Vitis vinifera] 55 8e-06 >emb|CAN73354.1| hypothetical protein VITISV_016753 [Vitis vinifera] Length = 1189 Score = 55.8 bits (133), Expect = 6e-06 Identities = 35/101 (34%), Positives = 54/101 (53%) Frame = -2 Query: 343 GDKALMKEYPSLSTLSRAADSFISELVVSSEDVTPQLSWNLQFRRRLSEAETTNVASLLL 164 GD+ L +YPSL + + IS ++ T SWNL FRR LS++E ++ L+ Sbjct: 916 GDQPLGSQYPSLFRVVLDKNIPISSVL----GPTRPFSWNLNFRRNLSDSEIEDLEGLMR 971 Query: 163 KLDPIRINPARLDTRSWPTQLLLRSVRLYSASPTLLCLARW 41 LD + ++P+ D RSWP L S L+S L L+++ Sbjct: 972 SLDGVHLSPSVPDARSWP----LSSSGLFSVKSFFLALSQF 1008 >emb|CAN69913.1| hypothetical protein VITISV_042568 [Vitis vinifera] Length = 863 Score = 55.5 bits (132), Expect = 8e-06 Identities = 34/100 (34%), Positives = 53/100 (53%) Frame = -2 Query: 343 GDKALMKEYPSLSTLSRAADSFISELVVSSEDVTPQLSWNLQFRRRLSEAETTNVASLLL 164 GD+ L +YP L + + +IS ++ S SWNL FRR LS++E ++ L+ Sbjct: 397 GDQPLGTQYPRLFRVVMDKNIYISSVLGPSRP----FSWNLNFRRNLSDSEIEDLEGLMR 452 Query: 163 KLDPIRINPARLDTRSWPTQLLLRSVRLYSASPTLLCLAR 44 LD + ++P+ D R WP L S RL+S L L++ Sbjct: 453 SLDDLYLSPSVPDARLWP----LSSSRLFSIKSFFLALSQ 488