BLASTX nr result
ID: Cocculus23_contig00034912
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00034912 (214 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004238480.1| PREDICTED: dof zinc finger protein DOF4.3-li... 71 1e-10 ref|XP_004148826.1| PREDICTED: dof zinc finger protein DOF1.2-li... 71 2e-10 ref|XP_002526146.1| hypothetical protein RCOM_0137680 [Ricinus c... 70 2e-10 gb|EYU17425.1| hypothetical protein MIMGU_mgv1a012301mg [Mimulus... 70 3e-10 ref|NP_190812.1| Dof zinc finger protein DOF3.5 [Arabidopsis tha... 70 3e-10 ref|XP_007137553.1| hypothetical protein PHAVU_009G136400g [Phas... 70 3e-10 ref|XP_006403804.1| hypothetical protein EUTSA_v10010919mg [Eutr... 70 3e-10 ref|XP_006854614.1| hypothetical protein AMTR_s00030p00153440 [A... 70 3e-10 ref|XP_006293263.1| hypothetical protein CARUB_v10019599mg [Caps... 70 3e-10 ref|XP_002876144.1| Dof-type zinc finger domain-containing prote... 70 3e-10 dbj|BAH30484.1| hypothetical protein [Arabidopsis thaliana] 70 3e-10 ref|XP_006434423.1| hypothetical protein CICLE_v10002179mg [Citr... 70 4e-10 ref|XP_007019428.1| F-box family protein, putative [Theobroma ca... 70 4e-10 gb|AGL40021.1| dof17 protein, partial [Sorghum bicolor] 70 4e-10 ref|XP_006348572.1| PREDICTED: dof zinc finger protein DOF2.5-li... 69 7e-10 ref|XP_007162976.1| hypothetical protein PHAVU_001G196100g [Phas... 69 7e-10 ref|XP_006843242.1| hypothetical protein AMTR_s00080p00087770 [A... 69 7e-10 gb|EYU27988.1| hypothetical protein MIMGU_mgv1a027100mg [Mimulus... 69 9e-10 gb|EXC12989.1| Dof zinc finger protein [Morus notabilis] 69 9e-10 ref|XP_006654467.1| PREDICTED: uncharacterized protein LOC102700... 69 9e-10 >ref|XP_004238480.1| PREDICTED: dof zinc finger protein DOF4.3-like [Solanum lycopersicum] Length = 267 Score = 71.2 bits (173), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 1 RYFCKACRRYWTKGGSLRNVPFGGGCRKSHRTK 99 RYFCKACRRYWTKGGSLRNVP GGGCRKS R++ Sbjct: 48 RYFCKACRRYWTKGGSLRNVPVGGGCRKSRRSR 80 >ref|XP_004148826.1| PREDICTED: dof zinc finger protein DOF1.2-like [Cucumis sativus] gi|449521872|ref|XP_004167953.1| PREDICTED: dof zinc finger protein DOF1.2-like [Cucumis sativus] Length = 243 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 1 RYFCKACRRYWTKGGSLRNVPFGGGCRKSHRTK 99 RYFCK+CRRYWTKGGSLRNVP GGGCRKS R K Sbjct: 54 RYFCKSCRRYWTKGGSLRNVPVGGGCRKSRRAK 86 >ref|XP_002526146.1| hypothetical protein RCOM_0137680 [Ricinus communis] gi|223534523|gb|EEF36222.1| hypothetical protein RCOM_0137680 [Ricinus communis] Length = 294 Score = 70.5 bits (171), Expect = 2e-10 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = +1 Query: 1 RYFCKACRRYWTKGGSLRNVPFGGGCRKSHRTK 99 RYFCK CRRYWTKGGSLRNVP GGGCRKS R K Sbjct: 47 RYFCKGCRRYWTKGGSLRNVPVGGGCRKSRRAK 79 >gb|EYU17425.1| hypothetical protein MIMGU_mgv1a012301mg [Mimulus guttatus] Length = 254 Score = 70.1 bits (170), Expect = 3e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 RYFCKACRRYWTKGGSLRNVPFGGGCRKSHRTK 99 RYFCKACRRYWTKGGSLRNVP GGGCRK+ R++ Sbjct: 70 RYFCKACRRYWTKGGSLRNVPVGGGCRKTRRSR 102 >ref|NP_190812.1| Dof zinc finger protein DOF3.5 [Arabidopsis thaliana] gi|55584005|sp|Q9SVC5.1|DOF35_ARATH RecName: Full=Dof zinc finger protein DOF3.5; Short=AtDOF3.5 gi|4886283|emb|CAB43436.1| putative DNA-binding protein [Arabidopsis thaliana] gi|332645425|gb|AEE78946.1| Dof zinc finger protein DOF3.5 [Arabidopsis thaliana] Length = 247 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = +1 Query: 1 RYFCKACRRYWTKGGSLRNVPFGGGCRKSHRTK 99 RYFCK CRRYWTKGGSLRNVP GGGCRKS R K Sbjct: 49 RYFCKGCRRYWTKGGSLRNVPVGGGCRKSRRPK 81 >ref|XP_007137553.1| hypothetical protein PHAVU_009G136400g [Phaseolus vulgaris] gi|561010640|gb|ESW09547.1| hypothetical protein PHAVU_009G136400g [Phaseolus vulgaris] Length = 298 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 1 RYFCKACRRYWTKGGSLRNVPFGGGCRKSHRTK 99 RYFCKACRRYWTKGGSLRNVP GGGCRK+ R K Sbjct: 63 RYFCKACRRYWTKGGSLRNVPVGGGCRKNRRGK 95 >ref|XP_006403804.1| hypothetical protein EUTSA_v10010919mg [Eutrema salsugineum] gi|557104923|gb|ESQ45257.1| hypothetical protein EUTSA_v10010919mg [Eutrema salsugineum] Length = 247 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = +1 Query: 1 RYFCKACRRYWTKGGSLRNVPFGGGCRKSHRTK 99 RYFCK CRRYWTKGGSLRNVP GGGCRKS R K Sbjct: 49 RYFCKGCRRYWTKGGSLRNVPVGGGCRKSRRPK 81 >ref|XP_006854614.1| hypothetical protein AMTR_s00030p00153440 [Amborella trichopoda] gi|548858300|gb|ERN16081.1| hypothetical protein AMTR_s00030p00153440 [Amborella trichopoda] Length = 280 Score = 70.1 bits (170), Expect = 3e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 RYFCKACRRYWTKGGSLRNVPFGGGCRKSHRTK 99 RYFCK+CRRYWTKGGSLRNVP GGGCRK+ R+K Sbjct: 37 RYFCKSCRRYWTKGGSLRNVPVGGGCRKNRRSK 69 >ref|XP_006293263.1| hypothetical protein CARUB_v10019599mg [Capsella rubella] gi|482561970|gb|EOA26161.1| hypothetical protein CARUB_v10019599mg [Capsella rubella] Length = 249 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = +1 Query: 1 RYFCKACRRYWTKGGSLRNVPFGGGCRKSHRTK 99 RYFCK CRRYWTKGGSLRNVP GGGCRKS R K Sbjct: 49 RYFCKGCRRYWTKGGSLRNVPVGGGCRKSRRPK 81 >ref|XP_002876144.1| Dof-type zinc finger domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297321982|gb|EFH52403.1| Dof-type zinc finger domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 250 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = +1 Query: 1 RYFCKACRRYWTKGGSLRNVPFGGGCRKSHRTK 99 RYFCK CRRYWTKGGSLRNVP GGGCRKS R K Sbjct: 49 RYFCKGCRRYWTKGGSLRNVPVGGGCRKSRRPK 81 >dbj|BAH30484.1| hypothetical protein [Arabidopsis thaliana] Length = 266 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = +1 Query: 1 RYFCKACRRYWTKGGSLRNVPFGGGCRKSHRTK 99 RYFCK CRRYWTKGGSLRNVP GGGCRKS R K Sbjct: 68 RYFCKGCRRYWTKGGSLRNVPVGGGCRKSRRPK 100 >ref|XP_006434423.1| hypothetical protein CICLE_v10002179mg [Citrus clementina] gi|557536545|gb|ESR47663.1| hypothetical protein CICLE_v10002179mg [Citrus clementina] Length = 265 Score = 69.7 bits (169), Expect = 4e-10 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 1 RYFCKACRRYWTKGGSLRNVPFGGGCRKSHRTK 99 RYFCK CRRYWTKGGSLRNVP GGGCRK+ R K Sbjct: 37 RYFCKGCRRYWTKGGSLRNVPMGGGCRKNRRVK 69 >ref|XP_007019428.1| F-box family protein, putative [Theobroma cacao] gi|508724756|gb|EOY16653.1| F-box family protein, putative [Theobroma cacao] Length = 305 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = +1 Query: 1 RYFCKACRRYWTKGGSLRNVPFGGGCRKSHRTK 99 RYFCK CRRYWTKGGSLRNVP GGGCRKS R K Sbjct: 54 RYFCKGCRRYWTKGGSLRNVPVGGGCRKSRRGK 86 >gb|AGL40021.1| dof17 protein, partial [Sorghum bicolor] Length = 311 Score = 69.7 bits (169), Expect = 4e-10 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 RYFCKACRRYWTKGGSLRNVPFGGGCRKSHR 93 RYFCK CRRYWTKGGSLRNVPFGGGCRK+ R Sbjct: 104 RYFCKTCRRYWTKGGSLRNVPFGGGCRKNKR 134 >ref|XP_006348572.1| PREDICTED: dof zinc finger protein DOF2.5-like [Solanum tuberosum] Length = 209 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +1 Query: 1 RYFCKACRRYWTKGGSLRNVPFGGGCRKSHR 93 RYFCK CRRYWTKGGSLRNVP GGGCRKS R Sbjct: 38 RYFCKGCRRYWTKGGSLRNVPIGGGCRKSRR 68 >ref|XP_007162976.1| hypothetical protein PHAVU_001G196100g [Phaseolus vulgaris] gi|561036440|gb|ESW34970.1| hypothetical protein PHAVU_001G196100g [Phaseolus vulgaris] Length = 261 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +1 Query: 1 RYFCKACRRYWTKGGSLRNVPFGGGCRKSHR 93 RYFCK CRRYWTKGGSLRNVP GGGCRKS R Sbjct: 38 RYFCKGCRRYWTKGGSLRNVPIGGGCRKSRR 68 >ref|XP_006843242.1| hypothetical protein AMTR_s00080p00087770 [Amborella trichopoda] gi|548845526|gb|ERN04917.1| hypothetical protein AMTR_s00080p00087770 [Amborella trichopoda] Length = 263 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 1 RYFCKACRRYWTKGGSLRNVPFGGGCRKSHRT 96 RYFCKACRRYWTKGGSLRNVP GGGCRK+ R+ Sbjct: 78 RYFCKACRRYWTKGGSLRNVPVGGGCRKNKRS 109 >gb|EYU27988.1| hypothetical protein MIMGU_mgv1a027100mg [Mimulus guttatus] Length = 296 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 1 RYFCKACRRYWTKGGSLRNVPFGGGCRKSHRTK 99 RYFCKACRRYWT+GG+LRNVP GGGCRKS R K Sbjct: 76 RYFCKACRRYWTQGGTLRNVPVGGGCRKSKRPK 108 >gb|EXC12989.1| Dof zinc finger protein [Morus notabilis] Length = 297 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 1 RYFCKACRRYWTKGGSLRNVPFGGGCRKSHRTK 99 RYFCK CRRYWTKGGSLRNVP GGGCRK+ R K Sbjct: 37 RYFCKGCRRYWTKGGSLRNVPVGGGCRKNRRGK 69 >ref|XP_006654467.1| PREDICTED: uncharacterized protein LOC102700144 [Oryza brachyantha] Length = 306 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 1 RYFCKACRRYWTKGGSLRNVPFGGGCRKSHRTK 99 RYFCK CRRYWTKGGSLRNVP GGGCRK+ R K Sbjct: 59 RYFCKGCRRYWTKGGSLRNVPVGGGCRKNRRGK 91