BLASTX nr result
ID: Cocculus23_contig00034792
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00034792 (217 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EWZ45254.1| hypothetical protein FOZG_05644 [Fusarium oxyspor... 63 5e-08 gb|EWY99173.1| hypothetical protein FOYG_03306 [Fusarium oxyspor... 63 5e-08 gb|EKJ75734.1| hypothetical protein FPSE_04116 [Fusarium pseudog... 63 5e-08 emb|CCT65722.1| probable glucose repressible protein Grg1 [Fusar... 62 6e-08 gb|EGU72104.1| hypothetical protein FOXB_17348 [Fusarium oxyspor... 62 6e-08 gb|EWG48101.1| hypothetical protein FVEG_08011 [Fusarium vertici... 62 8e-08 ref|XP_387328.1| hypothetical protein FG07152.1 [Fusarium gramin... 62 8e-08 gb|EXK42646.1| hypothetical protein FOMG_05478 [Fusarium oxyspor... 61 1e-07 ref|XP_003718290.1| glucose-repressible protein [Magnaporthe ory... 59 5e-07 gb|EKJ72103.1| hypothetical protein FPSE_07728 [Fusarium pseudog... 57 3e-06 ref|XP_388919.1| hypothetical protein FG08743.1 [Fusarium gramin... 57 3e-06 gb|EYB29907.1| hypothetical protein FG05_08743 [Fusarium gramine... 55 8e-06 ref|XP_753236.1| glucose repressible protein Grg1 [Aspergillus f... 55 8e-06 ref|XP_001259258.1| hypothetical protein NFIA_072750 [Neosartory... 55 8e-06 >gb|EWZ45254.1| hypothetical protein FOZG_05644 [Fusarium oxysporum Fo47] gi|587726589|gb|EWZ97926.1| hypothetical protein FOWG_02236 [Fusarium oxysporum f. sp. lycopersici MN25] gi|591427465|gb|EXL62602.1| hypothetical protein FOCG_01148 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] Length = 69 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -3 Query: 131 DAIKNAVSSASETVQQGISGVSKEGNKEVAKDSNAPTGTRAEA 3 D IKN V+ A+E VQ+GISG SKE NKEVAKDSNA GTRA A Sbjct: 2 DTIKNTVNQATEKVQEGISGTSKEANKEVAKDSNAGVGTRASA 44 >gb|EWY99173.1| hypothetical protein FOYG_03306 [Fusarium oxysporum FOSC 3-a] Length = 69 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -3 Query: 131 DAIKNAVSSASETVQQGISGVSKEGNKEVAKDSNAPTGTRAEA 3 D IKN V+ A+E VQ+GISG SKE NKEVAKDSNA GTRA A Sbjct: 2 DTIKNTVNQATEKVQEGISGTSKEANKEVAKDSNAGVGTRASA 44 >gb|EKJ75734.1| hypothetical protein FPSE_04116 [Fusarium pseudograminearum CS3096] Length = 69 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -3 Query: 131 DAIKNAVSSASETVQQGISGVSKEGNKEVAKDSNAPTGTRAEA 3 D IKN V+ A+E VQ+GISG SKE NKEVAKDSNA GTRA A Sbjct: 2 DTIKNTVNQATEKVQEGISGTSKEANKEVAKDSNAGVGTRASA 44 >emb|CCT65722.1| probable glucose repressible protein Grg1 [Fusarium fujikuroi IMI 58289] Length = 69 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 131 DAIKNAVSSASETVQQGISGVSKEGNKEVAKDSNAPTGTRAEA 3 D+IKN V+ A+E VQ+G+SG SKE NKEVAKDSNA GTRA A Sbjct: 2 DSIKNTVNQATEKVQEGLSGTSKEANKEVAKDSNAGVGTRASA 44 >gb|EGU72104.1| hypothetical protein FOXB_17348 [Fusarium oxysporum Fo5176] gi|475667407|gb|EMT65196.1| Glucose-repressible protein [Fusarium oxysporum f. sp. cubense race 4] gi|587752807|gb|EXA50523.1| hypothetical protein FOVG_03178 [Fusarium oxysporum f. sp. pisi HDV247] gi|590072565|gb|EXL00090.1| hypothetical protein FOQG_00399 [Fusarium oxysporum f. sp. raphani 54005] gi|591447663|gb|EXL80096.1| hypothetical protein FOPG_06289 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591476920|gb|EXM08072.1| hypothetical protein FOIG_02912 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591506835|gb|EXM36098.1| hypothetical protein FOTG_00386 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 69 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -3 Query: 131 DAIKNAVSSASETVQQGISGVSKEGNKEVAKDSNAPTGTRAEA 3 D IKN V+ A+E VQ+GISG SKE NKEVAKDSNA GTRA A Sbjct: 2 DTIKNTVNQATEKVQEGISGTSKEANKEVAKDSNAGIGTRASA 44 >gb|EWG48101.1| hypothetical protein FVEG_08011 [Fusarium verticillioides 7600] Length = 69 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 131 DAIKNAVSSASETVQQGISGVSKEGNKEVAKDSNAPTGTRAEA 3 D+IKN V+ A+E VQ+G+SG SKE NKEVAKDSNA GTRA A Sbjct: 2 DSIKNTVNQATEKVQEGLSGTSKEANKEVAKDSNAGIGTRASA 44 >ref|XP_387328.1| hypothetical protein FG07152.1 [Fusarium graminearum PH-1] gi|558863276|gb|ESU13359.1| hypothetical protein FGSG_07152 [Fusarium graminearum PH-1] gi|596546600|gb|EYB26551.1| hypothetical protein FG05_07152 [Fusarium graminearum] Length = 69 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 131 DAIKNAVSSASETVQQGISGVSKEGNKEVAKDSNAPTGTRAEA 3 D+IKN V+ A+E VQ+G+SG SKE NKEVAKDSNA GTRA A Sbjct: 2 DSIKNTVNQATEKVQEGLSGTSKEANKEVAKDSNAGIGTRASA 44 >gb|EXK42646.1| hypothetical protein FOMG_05478 [Fusarium oxysporum f. sp. melonis 26406] Length = 69 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -3 Query: 131 DAIKNAVSSASETVQQGISGVSKEGNKEVAKDSNAPTGTRAEA 3 D IKN V+ A+E VQ+GISG SKE NK+VAKDSNA GTRA A Sbjct: 2 DTIKNTVNQATEKVQEGISGTSKEANKDVAKDSNAGIGTRASA 44 >ref|XP_003718290.1| glucose-repressible protein [Magnaporthe oryzae 70-15] gi|59803120|gb|AAX07712.1| glucose-repressible gene protein-like protein [Magnaporthe grisea] gi|291195727|gb|ADD84580.1| glucose-repressible protein [Magnaporthe oryzae] gi|351640843|gb|EHA48706.1| glucose-repressible protein [Magnaporthe oryzae 70-15] gi|440466814|gb|ELQ36058.1| hypothetical protein OOU_Y34scaffold00669g43 [Magnaporthe oryzae Y34] gi|440480298|gb|ELQ60972.1| hypothetical protein OOW_P131scaffold01213g44 [Magnaporthe oryzae P131] Length = 71 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = -3 Query: 131 DAIKNAVSSASETVQQGISGVSKEGNKEVAKDSNAPTGTRAEA 3 D +KNA + SETVQ SG SKE NKEVAKD+NA GTRAEA Sbjct: 2 DTVKNAANYVSETVQSATSGASKEANKEVAKDNNASLGTRAEA 44 >gb|EKJ72103.1| hypothetical protein FPSE_07728 [Fusarium pseudograminearum CS3096] Length = 69 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -3 Query: 131 DAIKNAVSSASETVQQGISGVSKEGNKEVAKDSNAPTGTRAEA 3 D++K V+ +ETVQQ SG SKE NK+VAKDS+AP GTRA A Sbjct: 2 DSLKQGVNYVAETVQQATSGASKEANKQVAKDSDAPIGTRASA 44 >ref|XP_388919.1| hypothetical protein FG08743.1 [Fusarium graminearum PH-1] gi|558864476|gb|ESU14559.1| hypothetical protein FGSG_08743 [Fusarium graminearum PH-1] Length = 69 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -3 Query: 131 DAIKNAVSSASETVQQGISGVSKEGNKEVAKDSNAPTGTRAEA 3 +++K V+ +ETVQQ SG SKE NK+VAKDSNAP GTRA A Sbjct: 2 ESLKQGVNYVAETVQQAASGASKETNKQVAKDSNAPIGTRASA 44 >gb|EYB29907.1| hypothetical protein FG05_08743 [Fusarium graminearum] Length = 69 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -3 Query: 131 DAIKNAVSSASETVQQGISGVSKEGNKEVAKDSNAPTGTRAEA 3 +++K V+ +ETVQQ SG SKE NK+VAKD+NAP GTRA A Sbjct: 2 ESLKQGVNYVAETVQQAASGASKETNKQVAKDNNAPIGTRASA 44 >ref|XP_753236.1| glucose repressible protein Grg1 [Aspergillus fumigatus Af293] gi|66850872|gb|EAL91198.1| glucose repressible protein Grg1, putative [Aspergillus fumigatus Af293] gi|159127037|gb|EDP52153.1| glucose repressible protein Grg1, putative [Aspergillus fumigatus A1163] Length = 69 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -3 Query: 131 DAIKNAVSSASETVQQGISGVSKEGNKEVAKDSNAPTGTRAEA 3 ++IK V+ SE+VQQ + G SKE NK+VAKDS+AP GTRA A Sbjct: 2 ESIKQGVNYVSESVQQAVHGTSKEANKQVAKDSDAPIGTRASA 44 >ref|XP_001259258.1| hypothetical protein NFIA_072750 [Neosartorya fischeri NRRL 181] gi|119407412|gb|EAW17361.1| conserved hypothetical protein [Neosartorya fischeri NRRL 181] Length = 69 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -3 Query: 131 DAIKNAVSSASETVQQGISGVSKEGNKEVAKDSNAPTGTRAEA 3 ++IK V+ SE+VQQ + G SKE NK+VAKDS+AP GTRA A Sbjct: 2 ESIKQGVNYVSESVQQAVHGTSKEANKDVAKDSDAPIGTRASA 44