BLASTX nr result
ID: Cocculus23_contig00034771
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00034771 (392 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME45401.1| cyclin like protein [Dothistroma septosporum NZE10] 56 6e-06 >gb|EME45401.1| cyclin like protein [Dothistroma septosporum NZE10] Length = 378 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/48 (60%), Positives = 35/48 (72%) Frame = -3 Query: 381 PAYQHSLPLEQTDYQPNKKLKTTNIWSRFLPTMNMTRAQQPGVTITGY 238 P + HSLPLE TD QP KK K TNI+SRFLPT ++R Q P + +TGY Sbjct: 333 PLHAHSLPLEHTDQQPAKKQK-TNIFSRFLPT-TLSRPQLPPIQVTGY 378