BLASTX nr result
ID: Cocculus23_contig00034742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00034742 (283 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006372510.1| hypothetical protein POPTR_0017s02320g [Popu... 55 8e-06 ref|XP_006388570.1| hypothetical protein POPTR_0154s00250g [Popu... 55 8e-06 >ref|XP_006372510.1| hypothetical protein POPTR_0017s02320g [Populus trichocarpa] gi|550319136|gb|ERP50307.1| hypothetical protein POPTR_0017s02320g [Populus trichocarpa] Length = 497 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +2 Query: 5 SLEIFDCPHLKERCTKEQGKDWYKIAHIPWVRIN 106 SL I+DCP+L++RC KE+GKDW KIAHIP + IN Sbjct: 464 SLVIYDCPNLEKRCEKERGKDWPKIAHIPDIEIN 497 >ref|XP_006388570.1| hypothetical protein POPTR_0154s00250g [Populus trichocarpa] gi|550310413|gb|ERP47484.1| hypothetical protein POPTR_0154s00250g [Populus trichocarpa] Length = 1024 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +2 Query: 5 SLEIFDCPHLKERCTKEQGKDWYKIAHIPWVRIN 106 SL I+DCP+L++RC KE+GKDW KIAHIP + IN Sbjct: 991 SLVIYDCPNLEKRCEKERGKDWPKIAHIPDIEIN 1024