BLASTX nr result
ID: Cocculus23_contig00034524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00034524 (225 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007044031.1| SCP1-like small phosphatase 5 isoform 4 [The... 57 4e-06 ref|XP_007044029.1| SCP1-like small phosphatase 5 isoform 2 [The... 57 4e-06 ref|XP_007044028.1| SCP1-like small phosphatase 5 isoform 1 [The... 57 4e-06 ref|XP_002303804.2| hypothetical protein POPTR_0003s17220g [Popu... 56 6e-06 >ref|XP_007044031.1| SCP1-like small phosphatase 5 isoform 4 [Theobroma cacao] gi|508707966|gb|EOX99862.1| SCP1-like small phosphatase 5 isoform 4 [Theobroma cacao] Length = 482 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 225 DLRPLIAKKFNLREKVAAAVHPSMNSLRGDMFER 124 D+RPLIAKKFNLREK+A AV+P +NS RGD FER Sbjct: 449 DVRPLIAKKFNLREKIAGAVYPPLNSNRGDPFER 482 >ref|XP_007044029.1| SCP1-like small phosphatase 5 isoform 2 [Theobroma cacao] gi|590692333|ref|XP_007044030.1| SCP1-like small phosphatase 5 isoform 2 [Theobroma cacao] gi|590692350|ref|XP_007044032.1| SCP1-like small phosphatase 5 isoform 2 [Theobroma cacao] gi|508707964|gb|EOX99860.1| SCP1-like small phosphatase 5 isoform 2 [Theobroma cacao] gi|508707965|gb|EOX99861.1| SCP1-like small phosphatase 5 isoform 2 [Theobroma cacao] gi|508707967|gb|EOX99863.1| SCP1-like small phosphatase 5 isoform 2 [Theobroma cacao] Length = 449 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 225 DLRPLIAKKFNLREKVAAAVHPSMNSLRGDMFER 124 D+RPLIAKKFNLREK+A AV+P +NS RGD FER Sbjct: 416 DVRPLIAKKFNLREKIAGAVYPPLNSNRGDPFER 449 >ref|XP_007044028.1| SCP1-like small phosphatase 5 isoform 1 [Theobroma cacao] gi|508707963|gb|EOX99859.1| SCP1-like small phosphatase 5 isoform 1 [Theobroma cacao] Length = 479 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 225 DLRPLIAKKFNLREKVAAAVHPSMNSLRGDMFER 124 D+RPLIAKKFNLREK+A AV+P +NS RGD FER Sbjct: 446 DVRPLIAKKFNLREKIAGAVYPPLNSNRGDPFER 479 >ref|XP_002303804.2| hypothetical protein POPTR_0003s17220g [Populus trichocarpa] gi|550343373|gb|EEE78783.2| hypothetical protein POPTR_0003s17220g [Populus trichocarpa] Length = 483 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -1 Query: 225 DLRPLIAKKFNLREKVAAAVHPSMNSLRGDMFER 124 D+RPLIAKK+NLR+K+AAAV+P +NS RGD FER Sbjct: 450 DVRPLIAKKYNLRQKIAAAVYPPLNSNRGDPFER 483