BLASTX nr result
ID: Cocculus23_contig00034369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00034369 (223 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002960642.1| hypothetical protein SELMODRAFT_437689 [Sela... 60 3e-07 ref|XP_002983396.1| hypothetical protein SELMODRAFT_445508 [Sela... 60 3e-07 >ref|XP_002960642.1| hypothetical protein SELMODRAFT_437689 [Selaginella moellendorffii] gi|300171581|gb|EFJ38181.1| hypothetical protein SELMODRAFT_437689 [Selaginella moellendorffii] Length = 839 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/45 (55%), Positives = 36/45 (80%) Frame = +3 Query: 3 ALLKKDRPTKELQKLCAEKLVEFLGQGTQSFITQLFQDLNDGSVL 137 ALLK ++P ELQ LC +KL +FLG GT+ F+TQLF+D+ DG+++ Sbjct: 33 ALLKNNKPKPELQTLCVDKLFDFLGDGTKQFVTQLFKDIEDGTLV 77 >ref|XP_002983396.1| hypothetical protein SELMODRAFT_445508 [Selaginella moellendorffii] gi|300149081|gb|EFJ15738.1| hypothetical protein SELMODRAFT_445508 [Selaginella moellendorffii] Length = 839 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/45 (55%), Positives = 36/45 (80%) Frame = +3 Query: 3 ALLKKDRPTKELQKLCAEKLVEFLGQGTQSFITQLFQDLNDGSVL 137 ALLK ++P ELQ LC +KL +FLG GT+ F+TQLF+D+ DG+++ Sbjct: 33 ALLKNNKPKPELQTLCVDKLFDFLGDGTKQFVTQLFKDIEDGTLV 77