BLASTX nr result
ID: Cocculus23_contig00033929
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00033929 (401 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAM37956.1| secretary abundant heat soluble protein 1 [Ramaz... 105 6e-21 >dbj|BAM37956.1| secretary abundant heat soluble protein 1 [Ramazzottius varieornatus] Length = 169 Score = 105 bits (262), Expect = 6e-21 Identities = 52/103 (50%), Positives = 67/103 (65%) Frame = -1 Query: 401 NAEIHHWITKEADGTFQHTIKVPAKNYVNQFKFKLGEEGQHTINNTEFKYTYREEGDKLI 222 N + H I KE D + H I VP KNY N FKL EEG NNTE KY Y E+G L Sbjct: 67 NHKTFHKIWKEGDH-YHHQISVPDKNYKNDVNFKLNEEGTTQHNNTEIKYKYTEDGGNLK 125 Query: 221 GDITFPANANKKVHEETVINGEELEKTYKLGDIVAKRWFKKAA 93 ++ P+ NK +H+E +NG+ELEKTYK+GD+ AKRW+KK++ Sbjct: 126 AEVHVPSR-NKVIHDEYKVNGDELEKTYKVGDVTAKRWYKKSS 167