BLASTX nr result
ID: Cocculus23_contig00032983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00032983 (542 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC98051.1| hypothetical protein BAUCODRAFT_120958 [Baudoinia... 56 6e-06 >gb|EMC98051.1| hypothetical protein BAUCODRAFT_120958 [Baudoinia compniacensis UAMH 10762] Length = 304 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/48 (52%), Positives = 33/48 (68%) Frame = +2 Query: 380 IEAPRWSWTNSQAPATPRMYVPTIASSKNSATRLRMAVNWVRTRGERI 523 + RWSWTNSQAP TPR+Y P++ SS +S +R +WVR+R RI Sbjct: 227 VSPDRWSWTNSQAPPTPRVYAPSLHSSISSLSRFLGVRSWVRSRPWRI 274