BLASTX nr result
ID: Cocculus23_contig00032689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00032689 (229 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006476673.1| PREDICTED: LOB domain-containing protein 27-... 105 5e-21 ref|XP_006439670.1| hypothetical protein CICLE_v10021399mg [Citr... 105 5e-21 gb|EXB42061.1| hypothetical protein L484_006407 [Morus notabilis] 103 3e-20 ref|XP_004148705.1| PREDICTED: protein IAL1-like [Cucumis sativu... 102 6e-20 ref|XP_003634270.1| PREDICTED: LOW QUALITY PROTEIN: LOB domain-c... 102 6e-20 ref|XP_002511502.1| LOB domain-containing protein, putative [Ric... 102 6e-20 emb|CBI15291.3| unnamed protein product [Vitis vinifera] 102 6e-20 ref|XP_002321540.1| LOB domain protein 27 [Populus trichocarpa] ... 98 1e-18 ref|XP_007155357.1| hypothetical protein PHAVU_003G194300g [Phas... 97 2e-18 ref|XP_004508794.1| PREDICTED: LOB domain-containing protein 27-... 97 2e-18 ref|XP_004301305.1| PREDICTED: LOB domain-containing protein 27-... 97 2e-18 ref|XP_007216458.1| hypothetical protein PRUPE_ppa023282mg [Prun... 97 2e-18 emb|CBI35027.3| unnamed protein product [Vitis vinifera] 97 3e-18 emb|CAN76952.1| hypothetical protein VITISV_040518 [Vitis vinifera] 97 3e-18 ref|XP_006367708.1| PREDICTED: LOB domain-containing protein 27-... 96 7e-18 ref|XP_007208828.1| hypothetical protein PRUPE_ppa025223mg [Prun... 96 7e-18 ref|XP_004236523.1| PREDICTED: LOB domain-containing protein 27-... 96 7e-18 ref|XP_006376825.1| hypothetical protein POPTR_0012s07390g [Popu... 95 9e-18 ref|XP_002317998.1| LOB domain protein 27 [Populus trichocarpa] ... 95 9e-18 ref|XP_006292170.1| hypothetical protein CARUB_v10018376mg [Caps... 95 1e-17 >ref|XP_006476673.1| PREDICTED: LOB domain-containing protein 27-like [Citrus sinensis] Length = 300 Score = 105 bits (263), Expect = 5e-21 Identities = 46/53 (86%), Positives = 50/53 (94%) Frame = -3 Query: 161 MTVKGGTSQACAACKYQRRKCSADCALAPYFPPDQPKLFHNAHKLFGVSNIVK 3 MT+KGGTSQACA CKYQRR+CSA+C LAPYFPPDQPK+F NAHKLFGVSNIVK Sbjct: 1 MTLKGGTSQACAVCKYQRRRCSAECLLAPYFPPDQPKMFQNAHKLFGVSNIVK 53 >ref|XP_006439670.1| hypothetical protein CICLE_v10021399mg [Citrus clementina] gi|557541932|gb|ESR52910.1| hypothetical protein CICLE_v10021399mg [Citrus clementina] Length = 297 Score = 105 bits (263), Expect = 5e-21 Identities = 46/53 (86%), Positives = 50/53 (94%) Frame = -3 Query: 161 MTVKGGTSQACAACKYQRRKCSADCALAPYFPPDQPKLFHNAHKLFGVSNIVK 3 MT+KGGTSQACA CKYQRR+CSA+C LAPYFPPDQPK+F NAHKLFGVSNIVK Sbjct: 1 MTLKGGTSQACAVCKYQRRRCSAECLLAPYFPPDQPKMFQNAHKLFGVSNIVK 53 >gb|EXB42061.1| hypothetical protein L484_006407 [Morus notabilis] Length = 306 Score = 103 bits (257), Expect = 3e-20 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -3 Query: 161 MTVKGGTSQACAACKYQRRKCSADCALAPYFPPDQPKLFHNAHKLFGVSNIVK 3 MT+KGGTSQACAACKYQRR+C+A+C LAPYFPPDQPK+F NAHKLFGV NI+K Sbjct: 1 MTLKGGTSQACAACKYQRRRCTAECLLAPYFPPDQPKIFQNAHKLFGVKNILK 53 >ref|XP_004148705.1| PREDICTED: protein IAL1-like [Cucumis sativus] gi|449531719|ref|XP_004172833.1| PREDICTED: protein IAL1-like [Cucumis sativus] Length = 308 Score = 102 bits (254), Expect = 6e-20 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -3 Query: 161 MTVKGGTSQACAACKYQRRKCSADCALAPYFPPDQPKLFHNAHKLFGVSNIVK 3 MT+KGGTSQACAACKYQRR+CS DCALAPYFP DQPK+F NAH+LFGV NI+K Sbjct: 1 MTIKGGTSQACAACKYQRRRCSKDCALAPYFPADQPKMFQNAHRLFGVCNIMK 53 >ref|XP_003634270.1| PREDICTED: LOW QUALITY PROTEIN: LOB domain-containing protein 27-like, partial [Vitis vinifera] Length = 323 Score = 102 bits (254), Expect = 6e-20 Identities = 44/53 (83%), Positives = 51/53 (96%) Frame = -3 Query: 161 MTVKGGTSQACAACKYQRRKCSADCALAPYFPPDQPKLFHNAHKLFGVSNIVK 3 MT+KGGTSQACAACKYQRRKCS++C LAPYFPPDQPK+F +AH+LFGVSNI+K Sbjct: 23 MTLKGGTSQACAACKYQRRKCSSECPLAPYFPPDQPKMFADAHRLFGVSNILK 75 >ref|XP_002511502.1| LOB domain-containing protein, putative [Ricinus communis] gi|223550617|gb|EEF52104.1| LOB domain-containing protein, putative [Ricinus communis] Length = 284 Score = 102 bits (254), Expect = 6e-20 Identities = 44/53 (83%), Positives = 48/53 (90%) Frame = -3 Query: 161 MTVKGGTSQACAACKYQRRKCSADCALAPYFPPDQPKLFHNAHKLFGVSNIVK 3 MT+KGGTSQACA+CKYQRRKCS +C LAPYFPPDQPK+F NAHKLFGV NI K Sbjct: 1 MTLKGGTSQACASCKYQRRKCSTECPLAPYFPPDQPKMFQNAHKLFGVRNITK 53 >emb|CBI15291.3| unnamed protein product [Vitis vinifera] Length = 301 Score = 102 bits (254), Expect = 6e-20 Identities = 44/53 (83%), Positives = 51/53 (96%) Frame = -3 Query: 161 MTVKGGTSQACAACKYQRRKCSADCALAPYFPPDQPKLFHNAHKLFGVSNIVK 3 MT+KGGTSQACAACKYQRRKCS++C LAPYFPPDQPK+F +AH+LFGVSNI+K Sbjct: 1 MTLKGGTSQACAACKYQRRKCSSECPLAPYFPPDQPKMFADAHRLFGVSNILK 53 >ref|XP_002321540.1| LOB domain protein 27 [Populus trichocarpa] gi|222868536|gb|EEF05667.1| LOB domain protein 27 [Populus trichocarpa] Length = 271 Score = 98.2 bits (243), Expect = 1e-18 Identities = 42/53 (79%), Positives = 47/53 (88%) Frame = -3 Query: 161 MTVKGGTSQACAACKYQRRKCSADCALAPYFPPDQPKLFHNAHKLFGVSNIVK 3 MT+KGGTSQACA+CKYQRRKCS +C LAPYFPPDQP+LF N HKLFGV I+K Sbjct: 1 MTLKGGTSQACASCKYQRRKCSPECPLAPYFPPDQPRLFQNTHKLFGVRKILK 53 >ref|XP_007155357.1| hypothetical protein PHAVU_003G194300g [Phaseolus vulgaris] gi|561028711|gb|ESW27351.1| hypothetical protein PHAVU_003G194300g [Phaseolus vulgaris] Length = 300 Score = 97.4 bits (241), Expect = 2e-18 Identities = 42/53 (79%), Positives = 49/53 (92%) Frame = -3 Query: 161 MTVKGGTSQACAACKYQRRKCSADCALAPYFPPDQPKLFHNAHKLFGVSNIVK 3 MT+KGGT+QACAACK+QRRKC+++C LAPYFP DQPK+F N HKLFGVSNIVK Sbjct: 1 MTLKGGTTQACAACKHQRRKCTSECLLAPYFPADQPKIFLNVHKLFGVSNIVK 53 >ref|XP_004508794.1| PREDICTED: LOB domain-containing protein 27-like isoform X1 [Cicer arietinum] Length = 302 Score = 97.1 bits (240), Expect = 2e-18 Identities = 42/53 (79%), Positives = 48/53 (90%) Frame = -3 Query: 161 MTVKGGTSQACAACKYQRRKCSADCALAPYFPPDQPKLFHNAHKLFGVSNIVK 3 MT+KGGT+QACAACK+QRRKC+ +C LAPYFP DQPK+F N HKLFGVSNIVK Sbjct: 1 MTLKGGTTQACAACKFQRRKCTPECLLAPYFPADQPKIFLNVHKLFGVSNIVK 53 >ref|XP_004301305.1| PREDICTED: LOB domain-containing protein 27-like [Fragaria vesca subsp. vesca] Length = 339 Score = 97.1 bits (240), Expect = 2e-18 Identities = 42/53 (79%), Positives = 47/53 (88%) Frame = -3 Query: 161 MTVKGGTSQACAACKYQRRKCSADCALAPYFPPDQPKLFHNAHKLFGVSNIVK 3 MT+KG TSQACAACKYQRRKC+ +C LAPYFP DQPK+F NAHKLFGV NI+K Sbjct: 1 MTLKGATSQACAACKYQRRKCTPECPLAPYFPADQPKMFQNAHKLFGVCNILK 53 >ref|XP_007216458.1| hypothetical protein PRUPE_ppa023282mg [Prunus persica] gi|462412608|gb|EMJ17657.1| hypothetical protein PRUPE_ppa023282mg [Prunus persica] Length = 293 Score = 97.1 bits (240), Expect = 2e-18 Identities = 40/53 (75%), Positives = 49/53 (92%) Frame = -3 Query: 161 MTVKGGTSQACAACKYQRRKCSADCALAPYFPPDQPKLFHNAHKLFGVSNIVK 3 MT+KGGTSQACAACKYQRR+C+ DC L+P+FP DQPK+F NAH+L+GVSNI+K Sbjct: 1 MTIKGGTSQACAACKYQRRRCAKDCPLSPHFPADQPKMFQNAHRLYGVSNIMK 53 >emb|CBI35027.3| unnamed protein product [Vitis vinifera] Length = 243 Score = 96.7 bits (239), Expect = 3e-18 Identities = 43/53 (81%), Positives = 46/53 (86%) Frame = -3 Query: 161 MTVKGGTSQACAACKYQRRKCSADCALAPYFPPDQPKLFHNAHKLFGVSNIVK 3 MTVKGGTSQACAACKYQRRKCS C LAPYFP PKLF NAH+LFGVSN++K Sbjct: 1 MTVKGGTSQACAACKYQRRKCSDQCPLAPYFPASNPKLFQNAHRLFGVSNMMK 53 >emb|CAN76952.1| hypothetical protein VITISV_040518 [Vitis vinifera] Length = 319 Score = 96.7 bits (239), Expect = 3e-18 Identities = 43/53 (81%), Positives = 46/53 (86%) Frame = -3 Query: 161 MTVKGGTSQACAACKYQRRKCSADCALAPYFPPDQPKLFHNAHKLFGVSNIVK 3 MTVKGGTSQACAACKYQRRKCS C LAPYFP PKLF NAH+LFGVSN++K Sbjct: 36 MTVKGGTSQACAACKYQRRKCSDQCPLAPYFPASNPKLFQNAHRLFGVSNMMK 88 >ref|XP_006367708.1| PREDICTED: LOB domain-containing protein 27-like [Solanum tuberosum] Length = 301 Score = 95.5 bits (236), Expect = 7e-18 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = -3 Query: 161 MTVKGGTSQACAACKYQRRKCSADCALAPYFPPDQPKLFHNAHKLFGVSNIVK 3 MT+KGGTSQACAACKYQRR+C DC LAPYFP DQPK+F NAH+LFGVSNI+K Sbjct: 1 MTLKGGTSQACAACKYQRRRCH-DCPLAPYFPADQPKMFQNAHRLFGVSNILK 52 >ref|XP_007208828.1| hypothetical protein PRUPE_ppa025223mg [Prunus persica] gi|462404563|gb|EMJ10027.1| hypothetical protein PRUPE_ppa025223mg [Prunus persica] Length = 300 Score = 95.5 bits (236), Expect = 7e-18 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = -3 Query: 161 MTVKGGTSQACAACKYQRRKCSADCALAPYFPPDQPKLFHNAHKLFGVSNIVK 3 MT+KG T+ ACAACKYQRRKC+ +C LAP+FP DQPK+F NAHKLFGVSNIVK Sbjct: 1 MTLKGATNSACAACKYQRRKCTPECPLAPFFPADQPKMFQNAHKLFGVSNIVK 53 >ref|XP_004236523.1| PREDICTED: LOB domain-containing protein 27-like [Solanum lycopersicum] Length = 303 Score = 95.5 bits (236), Expect = 7e-18 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = -3 Query: 161 MTVKGGTSQACAACKYQRRKCSADCALAPYFPPDQPKLFHNAHKLFGVSNIVK 3 MT+KGGTSQACAACKYQRR+C DC LAPYFP DQPK+F NAH+LFGVSNI+K Sbjct: 1 MTLKGGTSQACAACKYQRRRCH-DCPLAPYFPADQPKMFQNAHRLFGVSNILK 52 >ref|XP_006376825.1| hypothetical protein POPTR_0012s07390g [Populus trichocarpa] gi|550326581|gb|ERP54622.1| hypothetical protein POPTR_0012s07390g [Populus trichocarpa] Length = 269 Score = 95.1 bits (235), Expect = 9e-18 Identities = 40/53 (75%), Positives = 48/53 (90%) Frame = -3 Query: 161 MTVKGGTSQACAACKYQRRKCSADCALAPYFPPDQPKLFHNAHKLFGVSNIVK 3 MT+KGGTSQACA+CKYQRRKCS++C LAPYFP +QPK+F NAHKLFGV I++ Sbjct: 1 MTLKGGTSQACASCKYQRRKCSSECPLAPYFPSEQPKMFQNAHKLFGVRKILR 53 >ref|XP_002317998.1| LOB domain protein 27 [Populus trichocarpa] gi|222858671|gb|EEE96218.1| LOB domain protein 27 [Populus trichocarpa] Length = 244 Score = 95.1 bits (235), Expect = 9e-18 Identities = 40/53 (75%), Positives = 48/53 (90%) Frame = -3 Query: 161 MTVKGGTSQACAACKYQRRKCSADCALAPYFPPDQPKLFHNAHKLFGVSNIVK 3 MT+KGGTSQACA+CKYQRRKCS++C LAPYFP +QPK+F NAHKLFGV I++ Sbjct: 1 MTLKGGTSQACASCKYQRRKCSSECPLAPYFPSEQPKMFQNAHKLFGVRKILR 53 >ref|XP_006292170.1| hypothetical protein CARUB_v10018376mg [Capsella rubella] gi|482560877|gb|EOA25068.1| hypothetical protein CARUB_v10018376mg [Capsella rubella] Length = 364 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = -3 Query: 161 MTVKGGTSQACAACKYQRRKCSADCALAPYFPPDQPKLFHNAHKLFGVSNIVK 3 MT+KGGTS ACAACKYQRR+C+ADC LAPYFP +QPKLF N H+LFGV +IVK Sbjct: 27 MTLKGGTSGACAACKYQRRRCAADCPLAPYFPAEQPKLFQNVHRLFGVRSIVK 79