BLASTX nr result
ID: Cocculus23_contig00032505
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00032505 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006660733.1| PREDICTED: multisite-specific tRNA:(cytosine... 55 8e-06 ref|XP_004240020.1| PREDICTED: tRNA (cytosine(34)-C(5))-methyltr... 55 8e-06 >ref|XP_006660733.1| PREDICTED: multisite-specific tRNA:(cytosine-C(5))-methyltransferase-like [Oryza brachyantha] Length = 879 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 326 CAAPGSKTFQLLEMIHQSTESGLLPAGMVLA 234 CAAPGSKTFQLLEMIHQST+ GLLP MV+A Sbjct: 197 CAAPGSKTFQLLEMIHQSTKPGLLPNAMVVA 227 >ref|XP_004240020.1| PREDICTED: tRNA (cytosine(34)-C(5))-methyltransferase-like [Solanum lycopersicum] Length = 823 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 326 CAAPGSKTFQLLEMIHQSTESGLLPAGMVLACSA 225 CAAPGSKTFQLLEMIH S E G LP GMVLA A Sbjct: 196 CAAPGSKTFQLLEMIHHSAEPGSLPGGMVLANDA 229