BLASTX nr result
ID: Cocculus23_contig00029962
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00029962 (502 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004165011.1| PREDICTED: PHD finger protein At1g33420-like... 61 1e-07 ref|XP_004144350.1| PREDICTED: PHD finger protein At1g33420-like... 61 1e-07 ref|XP_002305350.1| hypothetical protein POPTR_0004s14230g [Popu... 58 1e-06 ref|XP_007048631.1| RING/FYVE/PHD zinc finger superfamily protei... 58 2e-06 ref|XP_007143926.1| hypothetical protein PHAVU_007G114100g [Phas... 57 2e-06 ref|XP_004495439.1| PREDICTED: PHD finger protein At1g33420-like... 57 2e-06 ref|XP_002518819.1| DNA binding protein, putative [Ricinus commu... 57 2e-06 ref|XP_006360454.1| PREDICTED: PHD finger protein At1g33420-like... 57 3e-06 ref|XP_004236973.1| PREDICTED: PHD finger protein At1g33420-like... 57 4e-06 ref|XP_007214291.1| hypothetical protein PRUPE_ppb010612mg [Prun... 56 6e-06 ref|XP_006606402.1| PREDICTED: PHD finger protein At1g33420-like... 55 8e-06 ref|XP_002325292.2| hypothetical protein POPTR_0019s00330g [Popu... 55 8e-06 ref|XP_003536185.1| PREDICTED: PHD finger protein At1g33420-like... 55 8e-06 >ref|XP_004165011.1| PREDICTED: PHD finger protein At1g33420-like [Cucumis sativus] Length = 668 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +3 Query: 387 RSNVRSFLSKHGRYPAPCSLFPHLMIWQILLRIGDLV 497 RSNVR+FLSKH P P SLFPHL+ WQIL R+GDLV Sbjct: 16 RSNVRTFLSKHALLPPPSSLFPHLLTWQILFRVGDLV 52 >ref|XP_004144350.1| PREDICTED: PHD finger protein At1g33420-like [Cucumis sativus] Length = 668 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +3 Query: 387 RSNVRSFLSKHGRYPAPCSLFPHLMIWQILLRIGDLV 497 RSNVR+FLSKH P P SLFPHL+ WQIL R+GDLV Sbjct: 16 RSNVRTFLSKHALLPPPSSLFPHLLTWQILFRVGDLV 52 >ref|XP_002305350.1| hypothetical protein POPTR_0004s14230g [Populus trichocarpa] gi|222848314|gb|EEE85861.1| hypothetical protein POPTR_0004s14230g [Populus trichocarpa] Length = 688 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +3 Query: 387 RSNVRSFLSKHGRYPAPCSLFPHLMIWQILLRIGDLVD 500 RSNVRSFL++H P P SLFPHL+ WQI R+GDLV+ Sbjct: 51 RSNVRSFLTEHALLPPPSSLFPHLLTWQISFRVGDLVE 88 >ref|XP_007048631.1| RING/FYVE/PHD zinc finger superfamily protein isoform 1 [Theobroma cacao] gi|508700892|gb|EOX92788.1| RING/FYVE/PHD zinc finger superfamily protein isoform 1 [Theobroma cacao] Length = 700 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = +3 Query: 387 RSNVRSFLSKHGRYPAPCSLFPHLMIWQILLRIGDLVD 500 R+N+RSFL+KH P P SLFPHLM WQIL R+G+ D Sbjct: 39 RANIRSFLTKHALMPPPTSLFPHLMTWQILFRVGNATD 76 >ref|XP_007143926.1| hypothetical protein PHAVU_007G114100g [Phaseolus vulgaris] gi|561017116|gb|ESW15920.1| hypothetical protein PHAVU_007G114100g [Phaseolus vulgaris] Length = 712 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +3 Query: 387 RSNVRSFLSKHGRYPAPCSLFPHLMIWQILLRIGDLVD 500 RSNVRSFL+KH P P +LFPHL+ WQIL R+G+L + Sbjct: 45 RSNVRSFLTKHALLPPPYALFPHLLTWQILFRVGELTE 82 >ref|XP_004495439.1| PREDICTED: PHD finger protein At1g33420-like [Cicer arietinum] Length = 718 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +3 Query: 387 RSNVRSFLSKHGRYPAPCSLFPHLMIWQILLRIGDLVD 500 RSNVRSFL+K+ P P +LFPHLM WQIL RIG++ D Sbjct: 43 RSNVRSFLNKYALLPPPLALFPHLMTWQILFRIGEVTD 80 >ref|XP_002518819.1| DNA binding protein, putative [Ricinus communis] gi|223542200|gb|EEF43744.1| DNA binding protein, putative [Ricinus communis] Length = 677 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +3 Query: 387 RSNVRSFLSKHGRYPAPCSLFPHLMIWQILLRIGDLVD 500 R+N++SFL +H +P P SLFPHLM WQI R+GDL D Sbjct: 37 RTNIKSFLMEHALFPPPSSLFPHLMTWQISFRVGDLTD 74 >ref|XP_006360454.1| PREDICTED: PHD finger protein At1g33420-like [Solanum tuberosum] Length = 705 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = +3 Query: 387 RSNVRSFLSKHGRYPAPCSLFPHLMIWQILLRIGDLVD 500 R+ V+ FLSKH P P SLFPHL+ WQIL R+GDL D Sbjct: 38 RTTVKEFLSKHALLPPPSSLFPHLLTWQILFRVGDLTD 75 >ref|XP_004236973.1| PREDICTED: PHD finger protein At1g33420-like [Solanum lycopersicum] Length = 703 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = +3 Query: 387 RSNVRSFLSKHGRYPAPCSLFPHLMIWQILLRIGDLVD 500 R+ V+ FLSKH P P SLFPHL+ WQIL R+GDL D Sbjct: 38 RTTVKEFLSKHAILPPPSSLFPHLLTWQILFRVGDLTD 75 >ref|XP_007214291.1| hypothetical protein PRUPE_ppb010612mg [Prunus persica] gi|462410156|gb|EMJ15490.1| hypothetical protein PRUPE_ppb010612mg [Prunus persica] Length = 156 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = +3 Query: 387 RSNVRSFLSKHGRYPAPCSLFPHLMIWQILLRIGDLVD 500 R+ VR F+SKH P P SLFPHLM WQ+L R+GDL D Sbjct: 39 RTCVRDFISKHALLPPPSSLFPHLMTWQVLFRVGDLHD 76 >ref|XP_006606402.1| PREDICTED: PHD finger protein At1g33420-like isoform X1 [Glycine max] Length = 707 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = +3 Query: 387 RSNVRSFLSKHGRYPAPCSLFPHLMIWQILLRIGDLVD 500 RSNVR+FL+KH P P +LFPHL+ WQI+ R+G+L + Sbjct: 44 RSNVRAFLTKHALLPPPSALFPHLLTWQIVFRVGELTE 81 >ref|XP_002325292.2| hypothetical protein POPTR_0019s00330g [Populus trichocarpa] gi|550316360|gb|EEE99673.2| hypothetical protein POPTR_0019s00330g [Populus trichocarpa] Length = 683 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +3 Query: 387 RSNVRSFLSKHGRYPAPCSLFPHLMIWQILLRIGDLV 497 RSN+RSFL++H P P SLFPHL+ WQI ++GDLV Sbjct: 38 RSNIRSFLTEHALLPPPSSLFPHLLTWQISFQVGDLV 74 >ref|XP_003536185.1| PREDICTED: PHD finger protein At1g33420-like isoform X1 [Glycine max] Length = 707 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = +3 Query: 387 RSNVRSFLSKHGRYPAPCSLFPHLMIWQILLRIGDLVD 500 RSNVR+FL+KH P P +LFPHL+ WQI+ R+G+L + Sbjct: 44 RSNVRAFLTKHALLPPPSALFPHLLTWQIVFRVGELTE 81