BLASTX nr result
ID: Cocculus23_contig00029656
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00029656 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN74695.1| hypothetical protein VITISV_024648 [Vitis vinifera] 60 2e-07 >emb|CAN74695.1| hypothetical protein VITISV_024648 [Vitis vinifera] Length = 1424 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 FLGYSLNHKGYKCLTPTGKIIISRDVIFDE 91 FLGYSLNHKGYKCL+P G I+ISRDVIFDE Sbjct: 756 FLGYSLNHKGYKCLSPNGNILISRDVIFDE 785