BLASTX nr result
ID: Cocculus23_contig00029636
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00029636 (523 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002446681.1| hypothetical protein SORBIDRAFT_06g020470 [S... 57 2e-06 >ref|XP_002446681.1| hypothetical protein SORBIDRAFT_06g020470 [Sorghum bicolor] gi|241937864|gb|EES11009.1| hypothetical protein SORBIDRAFT_06g020470 [Sorghum bicolor] Length = 855 Score = 57.4 bits (137), Expect = 2e-06 Identities = 44/116 (37%), Positives = 56/116 (48%), Gaps = 7/116 (6%) Frame = -2 Query: 348 RSYGTLSGSSIQDDSRKRSQLRGHSPKLDEINHEIQVLSIQDLQ------AAKTQSSLQS 187 RS T + S D +R +S + E H + DLQ K Q L S Sbjct: 722 RSTLTSNRSMTDDLTRTCRSETNYSKGVSEHGH-FDSIQEPDLQPNCFSRTLKLQKKLLS 780 Query: 186 PDGSHKICLRVQPQDKFELTIP*KPPFETYFCANSPYILCSSSNTLGN-SSRDADL 22 +H ICLR+QP +K + +P K F+TYFCA PY CS SN+ SSRD DL Sbjct: 781 SGAAHTICLRIQPHNKMDF-LP-KKEFDTYFCAYEPYEQCSRSNSRATYSSRDDDL 834