BLASTX nr result
ID: Cocculus23_contig00029589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00029589 (466 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFJ73425.1| hypothetical protein RF2, partial (chloroplast) [... 77 2e-12 gb|AEZ48748.1| hypothetical chloroplast RF2, partial [Phormium t... 77 2e-12 gb|AEX93974.1| hypothetical chloroplast RF21 (chloroplast) [Ozir... 77 2e-12 gb|AEX93969.1| hypothetical chloroplast RF21 (chloroplast) [Phor... 77 2e-12 gb|AFJ80093.1| hypothetical protein RF2, partial (chloroplast) [... 76 4e-12 ref|YP_001294396.1| hypothetical chloroplast RF2 [Dioscorea elep... 76 4e-12 ref|YP_009026481.1| Ycf2 (chloroplast) [Dendrobium officinale] g... 76 6e-12 ref|YP_008081939.1| Ycf2 (chloroplast) [Cymbidium mannii] gi|511... 76 6e-12 ref|YP_008081861.1| Ycf2 (chloroplast) [Cymbidium tracyanum] gi|... 76 6e-12 gb|AGK25548.1| Ycf2 (chloroplast) [Cymbidium mannii] gi|48266232... 76 6e-12 ref|YP_008081783.1| Ycf2 (chloroplast) [Cymbidium tortisepalum] ... 76 6e-12 ref|YP_008081705.1| Ycf2 (chloroplast) [Cymbidium sinense] gi|51... 76 6e-12 ref|YP_008081627.1| Ycf2 (chloroplast) [Cymbidium aloifolium] gi... 76 6e-12 ref|YP_006503733.1| hypothetical chloroplast RF21 (chloroplast) ... 76 6e-12 gb|AFJ80098.1| hypothetical protein RF2, partial (chloroplast) [... 76 6e-12 gb|AFJ80097.1| hypothetical protein RF2, partial (chloroplast) [... 76 6e-12 gb|AFJ80096.1| hypothetical protein RF2, partial (chloroplast) [... 76 6e-12 gb|AFJ80095.1| hypothetical protein RF2, partial (chloroplast) [... 76 6e-12 gb|AFJ80094.1| hypothetical protein RF2, partial (chloroplast) [... 76 6e-12 gb|AFJ80092.1| hypothetical protein RF2, partial (chloroplast) [... 76 6e-12 >gb|AFJ73425.1| hypothetical protein RF2, partial (chloroplast) [Apostasia sp. G244] Length = 496 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -3 Query: 443 LKIDQFDITIQFEFSKAISPCIIWIPNIQDLSVNESNYLSLALI 312 LKID+FDIT+QFE +KA+SPCIIWIPNI DL VNESNYLSL L+ Sbjct: 330 LKIDRFDITLQFELAKAMSPCIIWIPNIHDLYVNESNYLSLGLL 373 >gb|AEZ48748.1| hypothetical chloroplast RF2, partial [Phormium tenax] Length = 2285 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 440 KIDQFDITIQFEFSKAISPCIIWIPNIQDLSVNESNYLSLALI 312 KIDQFDIT+QFE +KA+SPCIIWIPNI DL VNESNYLSL L+ Sbjct: 1709 KIDQFDITLQFELAKAMSPCIIWIPNIHDLYVNESNYLSLGLL 1751 >gb|AEX93974.1| hypothetical chloroplast RF21 (chloroplast) [Oziroe biflora] Length = 2260 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 440 KIDQFDITIQFEFSKAISPCIIWIPNIQDLSVNESNYLSLALI 312 KIDQFDIT+QFE +KA+SPCIIWIPNI DL VNESNYLSL L+ Sbjct: 1689 KIDQFDITLQFELAKAMSPCIIWIPNIHDLYVNESNYLSLGLL 1731 >gb|AEX93969.1| hypothetical chloroplast RF21 (chloroplast) [Phormium tenax] Length = 2278 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 440 KIDQFDITIQFEFSKAISPCIIWIPNIQDLSVNESNYLSLALI 312 KIDQFDIT+QFE +KA+SPCIIWIPNI DL VNESNYLSL L+ Sbjct: 1702 KIDQFDITLQFELAKAMSPCIIWIPNIHDLYVNESNYLSLGLL 1744 >gb|AFJ80093.1| hypothetical protein RF2, partial (chloroplast) [Cypripedium margaritaceum] Length = 490 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = -3 Query: 440 KIDQFDITIQFEFSKAISPCIIWIPNIQDLSVNESNYLSLALIWFCQ 300 KID+FDIT+QFE +KA+SPCIIWIPNI DL VNESNYLSL L C+ Sbjct: 330 KIDRFDITLQFELAKAMSPCIIWIPNIHDLHVNESNYLSLGLSRDCE 376 >ref|YP_001294396.1| hypothetical chloroplast RF2 [Dioscorea elephantipes] gi|149390416|ref|YP_001294415.1| hypothetical chloroplast RF2 [Dioscorea elephantipes] gi|205412894|sp|A6MMQ1.1|YCF2_DIOEL RecName: Full=Protein Ycf2 gi|148668089|gb|ABR01473.1| hypothetical chloroplast RF2 [Dioscorea elephantipes] gi|148668108|gb|ABR01492.1| hypothetical chloroplast RF2 [Dioscorea elephantipes] Length = 2260 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 440 KIDQFDITIQFEFSKAISPCIIWIPNIQDLSVNESNYLSLALI 312 KIDQFDIT+QFE +KA+SPCIIWIPNI DL VNESNYLS+ L+ Sbjct: 1686 KIDQFDITLQFELAKAMSPCIIWIPNIHDLYVNESNYLSIGLL 1728 >ref|YP_009026481.1| Ycf2 (chloroplast) [Dendrobium officinale] gi|618750354|ref|YP_009026491.1| Ycf2 (chloroplast) [Dendrobium officinale] gi|507474363|gb|AGM48239.1| Ycf2 (chloroplast) [Dendrobium officinale] gi|507474372|gb|AGM48248.1| Ycf2 (chloroplast) [Dendrobium officinale] Length = 2289 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 440 KIDQFDITIQFEFSKAISPCIIWIPNIQDLSVNESNYLSLALI 312 KID+FDIT+QFE +KA+SPCIIWIPNI DL VNESNYLSL L+ Sbjct: 1711 KIDRFDITLQFELAKAMSPCIIWIPNIHDLHVNESNYLSLGLL 1753 >ref|YP_008081939.1| Ycf2 (chloroplast) [Cymbidium mannii] gi|511943551|ref|YP_008081928.1| Ycf2 (chloroplast) [Cymbidium mannii] gi|482662560|gb|AGK25782.1| Ycf2 (chloroplast) [Cymbidium mannii] gi|482662561|gb|AGK25783.1| Ycf2 (chloroplast) [Cymbidium mannii] Length = 2289 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 440 KIDQFDITIQFEFSKAISPCIIWIPNIQDLSVNESNYLSLALI 312 KID+FDIT+QFE +KA+SPCIIWIPNI DL VNESNYLSL L+ Sbjct: 1709 KIDRFDITLQFELAKAMSPCIIWIPNIHDLHVNESNYLSLGLL 1751 >ref|YP_008081861.1| Ycf2 (chloroplast) [Cymbidium tracyanum] gi|511943450|ref|YP_008081850.1| Ycf2 (chloroplast) [Cymbidium tracyanum] gi|482662402|gb|AGK25626.1| Ycf2 (chloroplast) [Cymbidium tracyanum] gi|482662403|gb|AGK25627.1| Ycf2 (chloroplast) [Cymbidium tracyanum] Length = 2282 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 440 KIDQFDITIQFEFSKAISPCIIWIPNIQDLSVNESNYLSLALI 312 KID+FDIT+QFE +KA+SPCIIWIPNI DL VNESNYLSL L+ Sbjct: 1702 KIDRFDITLQFELAKAMSPCIIWIPNIHDLHVNESNYLSLGLL 1744 >gb|AGK25548.1| Ycf2 (chloroplast) [Cymbidium mannii] gi|482662324|gb|AGK25549.1| Ycf2 (chloroplast) [Cymbidium mannii] Length = 2251 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 440 KIDQFDITIQFEFSKAISPCIIWIPNIQDLSVNESNYLSLALI 312 KID+FDIT+QFE +KA+SPCIIWIPNI DL VNESNYLSL L+ Sbjct: 1671 KIDRFDITLQFELAKAMSPCIIWIPNIHDLHVNESNYLSLGLL 1713 >ref|YP_008081783.1| Ycf2 (chloroplast) [Cymbidium tortisepalum] gi|512721398|ref|YP_008081772.1| Ycf2 (chloroplast) [Cymbidium tortisepalum] gi|482662165|gb|AGK25392.1| Ycf2 (chloroplast) [Cymbidium tortisepalum] gi|482662166|gb|AGK25393.1| Ycf2 (chloroplast) [Cymbidium tortisepalum] gi|482662244|gb|AGK25470.1| Ycf2 (chloroplast) [Cymbidium tortisepalum] gi|482662245|gb|AGK25471.1| Ycf2 (chloroplast) [Cymbidium tortisepalum] gi|482662481|gb|AGK25704.1| Ycf2 (chloroplast) [Cymbidium tortisepalum] gi|482662482|gb|AGK25705.1| Ycf2 (chloroplast) [Cymbidium tortisepalum] Length = 2285 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 440 KIDQFDITIQFEFSKAISPCIIWIPNIQDLSVNESNYLSLALI 312 KID+FDIT+QFE +KA+SPCIIWIPNI DL VNESNYLSL L+ Sbjct: 1705 KIDRFDITLQFELAKAMSPCIIWIPNIHDLHVNESNYLSLGLL 1747 >ref|YP_008081705.1| Ycf2 (chloroplast) [Cymbidium sinense] gi|511943337|ref|YP_008081694.1| Ycf2 (chloroplast) [Cymbidium sinense] gi|482662086|gb|AGK25314.1| Ycf2 (chloroplast) [Cymbidium sinense] gi|482662087|gb|AGK25315.1| Ycf2 (chloroplast) [Cymbidium sinense] Length = 2288 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 440 KIDQFDITIQFEFSKAISPCIIWIPNIQDLSVNESNYLSLALI 312 KID+FDIT+QFE +KA+SPCIIWIPNI DL VNESNYLSL L+ Sbjct: 1708 KIDRFDITLQFELAKAMSPCIIWIPNIHDLHVNESNYLSLGLL 1750 >ref|YP_008081627.1| Ycf2 (chloroplast) [Cymbidium aloifolium] gi|520850487|ref|YP_008081616.1| Ycf2 (chloroplast) [Cymbidium aloifolium] gi|482662007|gb|AGK25236.1| Ycf2 (chloroplast) [Cymbidium aloifolium] gi|482662008|gb|AGK25237.1| Ycf2 (chloroplast) [Cymbidium aloifolium] Length = 2289 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 440 KIDQFDITIQFEFSKAISPCIIWIPNIQDLSVNESNYLSLALI 312 KID+FDIT+QFE +KA+SPCIIWIPNI DL VNESNYLSL L+ Sbjct: 1709 KIDRFDITLQFELAKAMSPCIIWIPNIHDLHVNESNYLSLGLL 1751 >ref|YP_006503733.1| hypothetical chloroplast RF21 (chloroplast) [Erycina pusilla] gi|395001724|ref|YP_006503740.1| hypothetical chloroplast RF21 (chloroplast) [Erycina pusilla] gi|339431345|gb|AEJ72539.1| hypothetical chloroplast RF21 (chloroplast) [Erycina pusilla] gi|339431353|gb|AEJ72547.1| hypothetical chloroplast RF21 (chloroplast) [Erycina pusilla] Length = 2225 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 440 KIDQFDITIQFEFSKAISPCIIWIPNIQDLSVNESNYLSLALI 312 KID+FDIT+QFE +KA+SPCIIWIPNI DL VNESNYLSL L+ Sbjct: 1645 KIDRFDITLQFELAKAMSPCIIWIPNIHDLHVNESNYLSLGLL 1687 >gb|AFJ80098.1| hypothetical protein RF2, partial (chloroplast) [Cypripedium irapeanum] gi|387569786|gb|AFJ80099.1| hypothetical protein RF2, partial (chloroplast) [Cypripedium molle] Length = 493 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 440 KIDQFDITIQFEFSKAISPCIIWIPNIQDLSVNESNYLSLALI 312 KID+FDIT+QFE +KA+SPCIIWIPNI DL VNESNYLSL L+ Sbjct: 328 KIDRFDITLQFELAKAMSPCIIWIPNIHDLHVNESNYLSLGLL 370 >gb|AFJ80097.1| hypothetical protein RF2, partial (chloroplast) [Cypripedium subtropicum] Length = 495 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 440 KIDQFDITIQFEFSKAISPCIIWIPNIQDLSVNESNYLSLALI 312 KID+FDIT+QFE +KA+SPCIIWIPNI DL VNESNYLSL L+ Sbjct: 330 KIDRFDITLQFELAKAMSPCIIWIPNIHDLHVNESNYLSLGLL 372 >gb|AFJ80096.1| hypothetical protein RF2, partial (chloroplast) [Cypripedium debile] Length = 485 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 440 KIDQFDITIQFEFSKAISPCIIWIPNIQDLSVNESNYLSLALI 312 KID+FDIT+QFE +KA+SPCIIWIPNI DL VNESNYLSL L+ Sbjct: 320 KIDRFDITLQFELAKAMSPCIIWIPNIHDLHVNESNYLSLGLL 362 >gb|AFJ80095.1| hypothetical protein RF2, partial (chloroplast) [Cypripedium acaule] Length = 504 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 440 KIDQFDITIQFEFSKAISPCIIWIPNIQDLSVNESNYLSLALI 312 KID+FDIT+QFE +KA+SPCIIWIPNI DL VNESNYLSL L+ Sbjct: 339 KIDRFDITLQFELAKAMSPCIIWIPNIHDLHVNESNYLSLGLL 381 >gb|AFJ80094.1| hypothetical protein RF2, partial (chloroplast) [Cypripedium palangshanense] Length = 494 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 440 KIDQFDITIQFEFSKAISPCIIWIPNIQDLSVNESNYLSLALI 312 KID+FDIT+QFE +KA+SPCIIWIPNI DL VNESNYLSL L+ Sbjct: 329 KIDRFDITLQFELAKAMSPCIIWIPNIHDLHVNESNYLSLGLL 371 >gb|AFJ80092.1| hypothetical protein RF2, partial (chloroplast) [Cypripedium californicum] Length = 496 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 440 KIDQFDITIQFEFSKAISPCIIWIPNIQDLSVNESNYLSLALI 312 KID+FDIT+QFE +KA+SPCIIWIPNI DL VNESNYLSL L+ Sbjct: 331 KIDRFDITLQFELAKAMSPCIIWIPNIHDLHVNESNYLSLGLL 373