BLASTX nr result
ID: Cocculus23_contig00029452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00029452 (369 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCH50976.1| T4.15 [Malus x robusta] 55 5e-07 emb|CBL94163.1| putative RNA-directed DNA polymerase (Reverse tr... 55 5e-07 >emb|CCH50976.1| T4.15 [Malus x robusta] Length = 986 Score = 55.5 bits (132), Expect(2) = 5e-07 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -1 Query: 147 SYIVKLWERVIENRVRVETTDSINQF*FMPRKTTMEAIYL 28 S+ +KLWERVIE+R+R ET S NQF FMP ++TMEAIYL Sbjct: 644 SHTMKLWERVIEHRLRQETRVSDNQFGFMPGRSTMEAIYL 683 Score = 23.9 bits (50), Expect(2) = 5e-07 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -3 Query: 37 YILRTLMERYRE 2 Y+LR LMERYR+ Sbjct: 682 YLLRRLMERYRD 693 >emb|CBL94163.1| putative RNA-directed DNA polymerase (Reverse transcriptase) [Malus domestica] Length = 622 Score = 55.5 bits (132), Expect(2) = 5e-07 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -1 Query: 147 SYIVKLWERVIENRVRVETTDSINQF*FMPRKTTMEAIYL 28 S+ +KLWERVIE+R+R ET S NQF FMP ++TMEAIYL Sbjct: 248 SHTMKLWERVIEHRLRQETRVSDNQFGFMPGRSTMEAIYL 287 Score = 23.9 bits (50), Expect(2) = 5e-07 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -3 Query: 37 YILRTLMERYRE 2 Y+LR LMERYR+ Sbjct: 286 YLLRRLMERYRD 297