BLASTX nr result
ID: Cocculus23_contig00029276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00029276 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007209565.1| hypothetical protein PRUPE_ppa011053mg [Prun... 86 7e-15 ref|XP_007099628.1| Pathogenesis-related thaumatin-like protein,... 82 6e-14 ref|XP_002299547.2| P21 family protein [Populus trichocarpa] gi|... 82 8e-14 gb|AGC39181.1| thaumatin-like protein [Actinidia chinensis] 82 1e-13 gb|ACH54108.1| osmotin isoform precursor [Piper colubrinum] 82 1e-13 gb|ABX71220.1| osmotin [Piper colubrinum] 82 1e-13 emb|CAC22329.1| osmotin-like protein [Fagus sylvatica] 82 1e-13 gb|EYU38379.1| hypothetical protein MIMGU_mgv1a013131mg [Mimulus... 81 1e-13 ref|XP_004298782.1| PREDICTED: osmotin-like protein OSM34-like [... 81 1e-13 ref|XP_004143988.1| PREDICTED: thaumatin-like protein-like [Cucu... 81 1e-13 gb|AAO13658.1| osmotin-like protein linusitin [Linum usitatissimum] 81 2e-13 dbj|BAO09560.1| osmotin, partial [Morus alba] 80 2e-13 ref|XP_002299521.2| hypothetical protein POPTR_0001s09570g [Popu... 80 2e-13 gb|AGC39182.1| thaumatin-like protein [Actinidia eriantha] 80 2e-13 gb|AGC39180.1| thaumatin-like protein [Actinidia deliciosa] 80 2e-13 gb|ACZ67185.1| pathogenesis-related thaumatin, partial [Populus ... 80 2e-13 ref|XP_002509749.1| Osmotin precursor, putative [Ricinus communi... 80 2e-13 gb|ABK96488.1| unknown [Populus trichocarpa x Populus deltoides] 80 2e-13 ref|XP_006853304.1| hypothetical protein AMTR_s00032p00039030 [A... 80 3e-13 gb|ADD51187.1| thaumatin-like protein [Vitis cinerea var. heller... 80 3e-13 >ref|XP_007209565.1| hypothetical protein PRUPE_ppa011053mg [Prunus persica] gi|462405300|gb|EMJ10764.1| hypothetical protein PRUPE_ppa011053mg [Prunus persica] Length = 225 Score = 85.5 bits (210), Expect = 7e-15 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +2 Query: 2 SKFFKDRCPAAYSYPKDDPTSTFTCPGGTNYRVVFCP 112 S+FFKDRCP+AYSYPKDDPTSTFTCPGGTNYRVVFCP Sbjct: 189 SRFFKDRCPSAYSYPKDDPTSTFTCPGGTNYRVVFCP 225 >ref|XP_007099628.1| Pathogenesis-related thaumatin-like protein, putative [Theobroma cacao] gi|508728506|gb|EOY20403.1| Pathogenesis-related thaumatin-like protein, putative [Theobroma cacao] Length = 245 Score = 82.4 bits (202), Expect = 6e-14 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +2 Query: 2 SKFFKDRCPAAYSYPKDDPTSTFTCPGGTNYRVVFCP 112 SKFFKDRCP AYSYPKDD TSTFTCPGGTNYRVVFCP Sbjct: 209 SKFFKDRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 245 >ref|XP_002299547.2| P21 family protein [Populus trichocarpa] gi|550346867|gb|EEE84352.2| P21 family protein [Populus trichocarpa] Length = 245 Score = 82.0 bits (201), Expect = 8e-14 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +2 Query: 2 SKFFKDRCPAAYSYPKDDPTSTFTCPGGTNYRVVFCP 112 S+FFKDRCP +YSYP+DDPTSTFTCPGGTNYRV+FCP Sbjct: 192 SRFFKDRCPTSYSYPQDDPTSTFTCPGGTNYRVIFCP 228 >gb|AGC39181.1| thaumatin-like protein [Actinidia chinensis] Length = 228 Score = 81.6 bits (200), Expect = 1e-13 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 2 SKFFKDRCPAAYSYPKDDPTSTFTCPGGTNYRVVFCP 112 SKFFKDRCP AYSYP+DDPTS FTCPGGTNYRVVFCP Sbjct: 192 SKFFKDRCPDAYSYPQDDPTSLFTCPGGTNYRVVFCP 228 >gb|ACH54108.1| osmotin isoform precursor [Piper colubrinum] Length = 180 Score = 81.6 bits (200), Expect = 1e-13 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 2 SKFFKDRCPAAYSYPKDDPTSTFTCPGGTNYRVVFCP 112 S+FFK RCP AYSYPKDDPTSTFTCPGGTNYRVVFCP Sbjct: 144 SRFFKTRCPDAYSYPKDDPTSTFTCPGGTNYRVVFCP 180 >gb|ABX71220.1| osmotin [Piper colubrinum] Length = 230 Score = 81.6 bits (200), Expect = 1e-13 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 2 SKFFKDRCPAAYSYPKDDPTSTFTCPGGTNYRVVFCP 112 S+FFK RCP AYSYPKDDPTSTFTCPGGTNYRVVFCP Sbjct: 194 SRFFKTRCPDAYSYPKDDPTSTFTCPGGTNYRVVFCP 230 >emb|CAC22329.1| osmotin-like protein [Fagus sylvatica] Length = 125 Score = 81.6 bits (200), Expect = 1e-13 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 2 SKFFKDRCPAAYSYPKDDPTSTFTCPGGTNYRVVFCP 112 SKFFK RCP AYSYP+DDPTSTFTCPGGTNYRVVFCP Sbjct: 89 SKFFKQRCPDAYSYPQDDPTSTFTCPGGTNYRVVFCP 125 >gb|EYU38379.1| hypothetical protein MIMGU_mgv1a013131mg [Mimulus guttatus] Length = 230 Score = 81.3 bits (199), Expect = 1e-13 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +2 Query: 2 SKFFKDRCPAAYSYPKDDPTSTFTCPGGTNYRVVFCP 112 S+FFKDRCP AYSYP+DDP+STFTCPGGTNYRVVFCP Sbjct: 194 SRFFKDRCPDAYSYPQDDPSSTFTCPGGTNYRVVFCP 230 >ref|XP_004298782.1| PREDICTED: osmotin-like protein OSM34-like [Fragaria vesca subsp. vesca] Length = 248 Score = 81.3 bits (199), Expect = 1e-13 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 2 SKFFKDRCPAAYSYPKDDPTSTFTCPGGTNYRVVFCP 112 SKFFK RCP AYSYP+DDPTSTFTCPGGTNYRVVFCP Sbjct: 194 SKFFKTRCPDAYSYPQDDPTSTFTCPGGTNYRVVFCP 230 >ref|XP_004143988.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus] gi|449495895|ref|XP_004159977.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus] Length = 225 Score = 81.3 bits (199), Expect = 1e-13 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 2 SKFFKDRCPAAYSYPKDDPTSTFTCPGGTNYRVVFCP 112 S+FFKDRCP AYSYPKDD TSTFTCPGGTNYRVVFCP Sbjct: 189 SRFFKDRCPDAYSYPKDDATSTFTCPGGTNYRVVFCP 225 >gb|AAO13658.1| osmotin-like protein linusitin [Linum usitatissimum] Length = 263 Score = 80.9 bits (198), Expect = 2e-13 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +2 Query: 2 SKFFKDRCPAAYSYPKDDPTSTFTCPGGTNYRVVFCP 112 S+FFKDRCP +YSYP+DDP+STFTCPGGTNYRVVFCP Sbjct: 195 SRFFKDRCPTSYSYPQDDPSSTFTCPGGTNYRVVFCP 231 >dbj|BAO09560.1| osmotin, partial [Morus alba] Length = 231 Score = 80.5 bits (197), Expect = 2e-13 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 2 SKFFKDRCPAAYSYPKDDPTSTFTCPGGTNYRVVFCP 112 S+FFK RCP AYSYP+DDPTSTFTCPGGTNYRVVFCP Sbjct: 179 SRFFKQRCPDAYSYPQDDPTSTFTCPGGTNYRVVFCP 215 >ref|XP_002299521.2| hypothetical protein POPTR_0001s09570g [Populus trichocarpa] gi|550346899|gb|EEE84326.2| hypothetical protein POPTR_0001s09570g [Populus trichocarpa] Length = 246 Score = 80.5 bits (197), Expect = 2e-13 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = +2 Query: 2 SKFFKDRCPAAYSYPKDDPTSTFTCPGGTNYRVVFCP 112 S+FFKDRCP +YSYP+DDP+STFTCPGGTNYRV+FCP Sbjct: 193 SRFFKDRCPTSYSYPQDDPSSTFTCPGGTNYRVIFCP 229 >gb|AGC39182.1| thaumatin-like protein [Actinidia eriantha] Length = 228 Score = 80.5 bits (197), Expect = 2e-13 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 2 SKFFKDRCPAAYSYPKDDPTSTFTCPGGTNYRVVFCP 112 SKFFKDRCP AYSYP+DDPTS FTCPGGTNY+VVFCP Sbjct: 192 SKFFKDRCPDAYSYPQDDPTSLFTCPGGTNYKVVFCP 228 >gb|AGC39180.1| thaumatin-like protein [Actinidia deliciosa] Length = 228 Score = 80.5 bits (197), Expect = 2e-13 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 2 SKFFKDRCPAAYSYPKDDPTSTFTCPGGTNYRVVFCP 112 SKFFKDRCP AYSYP+DDPTS FTCPGGTNY+VVFCP Sbjct: 192 SKFFKDRCPDAYSYPQDDPTSLFTCPGGTNYKVVFCP 228 >gb|ACZ67185.1| pathogenesis-related thaumatin, partial [Populus deltoides] Length = 241 Score = 80.5 bits (197), Expect = 2e-13 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = +2 Query: 2 SKFFKDRCPAAYSYPKDDPTSTFTCPGGTNYRVVFCP 112 S+FFKDRCP +YSYP+DDP+STFTCPGGTNYRV+FCP Sbjct: 193 SRFFKDRCPTSYSYPQDDPSSTFTCPGGTNYRVIFCP 229 >ref|XP_002509749.1| Osmotin precursor, putative [Ricinus communis] gi|223549648|gb|EEF51136.1| Osmotin precursor, putative [Ricinus communis] Length = 225 Score = 80.5 bits (197), Expect = 2e-13 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 2 SKFFKDRCPAAYSYPKDDPTSTFTCPGGTNYRVVFCP 112 SKFFK+RCP AYSYP+DDPTSTFTCPGGTNYRV FCP Sbjct: 189 SKFFKNRCPDAYSYPQDDPTSTFTCPGGTNYRVTFCP 225 >gb|ABK96488.1| unknown [Populus trichocarpa x Populus deltoides] Length = 117 Score = 80.5 bits (197), Expect = 2e-13 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = +2 Query: 2 SKFFKDRCPAAYSYPKDDPTSTFTCPGGTNYRVVFCP 112 S+FFKDRCP +YSYP+DDP+STFTCPGGTNYRV+FCP Sbjct: 64 SRFFKDRCPTSYSYPQDDPSSTFTCPGGTNYRVIFCP 100 >ref|XP_006853304.1| hypothetical protein AMTR_s00032p00039030 [Amborella trichopoda] gi|548856957|gb|ERN14771.1| hypothetical protein AMTR_s00032p00039030 [Amborella trichopoda] Length = 231 Score = 80.1 bits (196), Expect = 3e-13 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +2 Query: 2 SKFFKDRCPAAYSYPKDDPTSTFTCPGGTNYRVVFCP 112 S+FFKDRCP AYSYPKDDP+STFTCP GTNYRV+FCP Sbjct: 195 SRFFKDRCPDAYSYPKDDPSSTFTCPSGTNYRVIFCP 231 >gb|ADD51187.1| thaumatin-like protein [Vitis cinerea var. helleri x Vitis riparia] Length = 239 Score = 80.1 bits (196), Expect = 3e-13 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 2 SKFFKDRCPAAYSYPKDDPTSTFTCPGGTNYRVVFCP 112 S+FFK RCP AYSYP+DDPTSTFTCPGGTNYRVVFCP Sbjct: 184 SRFFKTRCPDAYSYPQDDPTSTFTCPGGTNYRVVFCP 220