BLASTX nr result
ID: Cocculus23_contig00029023
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00029023 (246 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004145669.1| PREDICTED: DNA/RNA-binding protein KIN17-lik... 81 2e-13 ref|XP_002316291.1| Kin17 DNA-binding family protein [Populus tr... 81 2e-13 ref|XP_002311165.1| Kin17 DNA-binding family protein [Populus tr... 81 2e-13 ref|XP_007226396.1| hypothetical protein PRUPE_ppa023016mg [Prun... 80 3e-13 ref|XP_007218061.1| hypothetical protein PRUPE_ppa006825mg [Prun... 80 3e-13 ref|XP_007206196.1| hypothetical protein PRUPE_ppa014710mg [Prun... 80 3e-13 gb|EXC30506.1| hypothetical protein L484_010755 [Morus notabilis] 79 7e-13 ref|XP_004307520.1| PREDICTED: DNA/RNA-binding protein KIN17-lik... 79 7e-13 ref|XP_007211559.1| hypothetical protein PRUPE_ppa008277mg [Prun... 79 7e-13 ref|XP_002524993.1| zinc finger protein, putative [Ricinus commu... 79 9e-13 ref|XP_006392637.1| hypothetical protein EUTSA_v10011527mg [Eutr... 78 1e-12 ref|XP_006307680.1| hypothetical protein CARUB_v10009308mg [Caps... 78 1e-12 ref|XP_002457142.1| hypothetical protein SORBIDRAFT_03g001900 [S... 78 1e-12 ref|NP_001150142.1| antigenic determinant of rec-A protein [Zea ... 78 1e-12 ref|NP_564690.1| DNA/RNA-binding protein Kin17 conserved region-... 78 1e-12 ref|XP_002275968.1| PREDICTED: DNA/RNA-binding protein KIN17 [Vi... 78 1e-12 gb|EAZ27541.1| hypothetical protein OsJ_11495 [Oryza sativa Japo... 77 2e-12 gb|EAY90709.1| hypothetical protein OsI_12309 [Oryza sativa Indi... 77 2e-12 ref|NP_001050519.1| Os03g0570300 [Oryza sativa Japonica Group] g... 77 2e-12 ref|XP_002891834.1| predicted protein [Arabidopsis lyrata subsp.... 77 2e-12 >ref|XP_004145669.1| PREDICTED: DNA/RNA-binding protein KIN17-like [Cucumis sativus] gi|449533194|ref|XP_004173561.1| PREDICTED: DNA/RNA-binding protein KIN17-like [Cucumis sativus] Length = 397 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +2 Query: 2 YRGSNGRLISVDTNNYCAKVQIEKGIYDGRVLQAVEYEDICKLA 133 YRGSN RL+ VDT+ +CAKVQIEKG+YDGRVL+AVEYEDICKLA Sbjct: 353 YRGSNARLLGVDTDKFCAKVQIEKGVYDGRVLKAVEYEDICKLA 396 >ref|XP_002316291.1| Kin17 DNA-binding family protein [Populus trichocarpa] gi|222865331|gb|EEF02462.1| Kin17 DNA-binding family protein [Populus trichocarpa] Length = 400 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = +2 Query: 2 YRGSNGRLISVDTNNYCAKVQIEKGIYDGRVLQAVEYEDICKLA 133 YRGSN RL+ VDT +CAKVQIEKGIYDGRVL+AVEYEDICKLA Sbjct: 357 YRGSNARLLGVDTEKFCAKVQIEKGIYDGRVLKAVEYEDICKLA 400 >ref|XP_002311165.1| Kin17 DNA-binding family protein [Populus trichocarpa] gi|566182514|ref|XP_006379592.1| hypothetical protein POPTR_0008s05540g [Populus trichocarpa] gi|222850985|gb|EEE88532.1| Kin17 DNA-binding family protein [Populus trichocarpa] gi|550332485|gb|ERP57389.1| hypothetical protein POPTR_0008s05540g [Populus trichocarpa] Length = 396 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = +2 Query: 2 YRGSNGRLISVDTNNYCAKVQIEKGIYDGRVLQAVEYEDICKLA 133 YRGSN RL+ VDT +CAKVQIEKGIYDGRVL+AVEYEDICKLA Sbjct: 353 YRGSNARLLGVDTEKFCAKVQIEKGIYDGRVLKAVEYEDICKLA 396 >ref|XP_007226396.1| hypothetical protein PRUPE_ppa023016mg [Prunus persica] gi|462423332|gb|EMJ27595.1| hypothetical protein PRUPE_ppa023016mg [Prunus persica] Length = 369 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = +2 Query: 2 YRGSNGRLISVDTNNYCAKVQIEKGIYDGRVLQAVEYEDICKLA 133 YRGSN +L++VDT+ +CAKVQIEKG+YDGRVL+AVEYEDICKLA Sbjct: 326 YRGSNAKLLAVDTDKFCAKVQIEKGVYDGRVLKAVEYEDICKLA 369 >ref|XP_007218061.1| hypothetical protein PRUPE_ppa006825mg [Prunus persica] gi|462414523|gb|EMJ19260.1| hypothetical protein PRUPE_ppa006825mg [Prunus persica] Length = 393 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = +2 Query: 2 YRGSNGRLISVDTNNYCAKVQIEKGIYDGRVLQAVEYEDICKLA 133 YRGSN +L++VDT+ +CAKVQIEKG+YDGRVL+AVEYEDICKLA Sbjct: 350 YRGSNAKLLAVDTDKFCAKVQIEKGVYDGRVLKAVEYEDICKLA 393 >ref|XP_007206196.1| hypothetical protein PRUPE_ppa014710mg [Prunus persica] gi|462401838|gb|EMJ07395.1| hypothetical protein PRUPE_ppa014710mg [Prunus persica] Length = 373 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = +2 Query: 2 YRGSNGRLISVDTNNYCAKVQIEKGIYDGRVLQAVEYEDICKLA 133 YRGSN +L++VDT+ +CAKVQIEKG+YDGRVL+AVEYEDICKLA Sbjct: 330 YRGSNAKLLAVDTDKFCAKVQIEKGVYDGRVLKAVEYEDICKLA 373 >gb|EXC30506.1| hypothetical protein L484_010755 [Morus notabilis] Length = 368 Score = 79.0 bits (193), Expect = 7e-13 Identities = 34/43 (79%), Positives = 41/43 (95%) Frame = +2 Query: 2 YRGSNGRLISVDTNNYCAKVQIEKGIYDGRVLQAVEYEDICKL 130 YRGSN RL++VDT+ +CAKVQIEKG+YDGRVL+AVEYEDICK+ Sbjct: 324 YRGSNARLLAVDTDKFCAKVQIEKGVYDGRVLKAVEYEDICKI 366 >ref|XP_004307520.1| PREDICTED: DNA/RNA-binding protein KIN17-like [Fragaria vesca subsp. vesca] Length = 390 Score = 79.0 bits (193), Expect = 7e-13 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = +2 Query: 2 YRGSNGRLISVDTNNYCAKVQIEKGIYDGRVLQAVEYEDICKLA 133 YRGSN +L++VDT+ +CAKVQIEKG+YDGRVL+AV+YEDICKLA Sbjct: 347 YRGSNAKLLAVDTDKFCAKVQIEKGVYDGRVLKAVDYEDICKLA 390 >ref|XP_007211559.1| hypothetical protein PRUPE_ppa008277mg [Prunus persica] gi|462407424|gb|EMJ12758.1| hypothetical protein PRUPE_ppa008277mg [Prunus persica] Length = 338 Score = 79.0 bits (193), Expect = 7e-13 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = +2 Query: 2 YRGSNGRLISVDTNNYCAKVQIEKGIYDGRVLQAVEYEDICKLA 133 YRGSN +L++VDT+ +CAKVQIEKG+YDGR+L+AVEYEDICKLA Sbjct: 295 YRGSNAKLLAVDTDKFCAKVQIEKGVYDGRLLKAVEYEDICKLA 338 >ref|XP_002524993.1| zinc finger protein, putative [Ricinus communis] gi|223535737|gb|EEF37400.1| zinc finger protein, putative [Ricinus communis] Length = 398 Score = 78.6 bits (192), Expect = 9e-13 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = +2 Query: 2 YRGSNGRLISVDTNNYCAKVQIEKGIYDGRVLQAVEYEDICKLA 133 YRGSN RL+ VDT +CA VQIEKGIYDGRVL+AVEYEDICKLA Sbjct: 354 YRGSNARLLKVDTEKFCAMVQIEKGIYDGRVLKAVEYEDICKLA 397 >ref|XP_006392637.1| hypothetical protein EUTSA_v10011527mg [Eutrema salsugineum] gi|557089215|gb|ESQ29923.1| hypothetical protein EUTSA_v10011527mg [Eutrema salsugineum] Length = 414 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/44 (75%), Positives = 41/44 (93%) Frame = +2 Query: 2 YRGSNGRLISVDTNNYCAKVQIEKGIYDGRVLQAVEYEDICKLA 133 YRGSN RL+ VDT+ +CAKVQIEKG+YDGRV++++EYEDICKLA Sbjct: 371 YRGSNARLLGVDTDKFCAKVQIEKGVYDGRVVKSIEYEDICKLA 414 >ref|XP_006307680.1| hypothetical protein CARUB_v10009308mg [Capsella rubella] gi|482576391|gb|EOA40578.1| hypothetical protein CARUB_v10009308mg [Capsella rubella] Length = 409 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = +2 Query: 2 YRGSNGRLISVDTNNYCAKVQIEKGIYDGRVLQAVEYEDICKLA 133 YRGSN RL+ VDT +CAKVQIEKG+YDGRV++++EYEDICKLA Sbjct: 366 YRGSNARLLGVDTEKFCAKVQIEKGVYDGRVIKSIEYEDICKLA 409 >ref|XP_002457142.1| hypothetical protein SORBIDRAFT_03g001900 [Sorghum bicolor] gi|241929117|gb|EES02262.1| hypothetical protein SORBIDRAFT_03g001900 [Sorghum bicolor] Length = 424 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/44 (75%), Positives = 41/44 (93%) Frame = +2 Query: 2 YRGSNGRLISVDTNNYCAKVQIEKGIYDGRVLQAVEYEDICKLA 133 YRGSN RL+SVDT +CAKVQ+EKG+YDG+VL+AVEYEDICK++ Sbjct: 380 YRGSNARLLSVDTEKFCAKVQVEKGLYDGKVLRAVEYEDICKIS 423 >ref|NP_001150142.1| antigenic determinant of rec-A protein [Zea mays] gi|194707714|gb|ACF87941.1| unknown [Zea mays] gi|195637094|gb|ACG38015.1| antigenic determinant of rec-A protein [Zea mays] gi|413935581|gb|AFW70132.1| hypothetical protein ZEAMMB73_750082 [Zea mays] Length = 424 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/44 (75%), Positives = 41/44 (93%) Frame = +2 Query: 2 YRGSNGRLISVDTNNYCAKVQIEKGIYDGRVLQAVEYEDICKLA 133 YRGSN RL+SVDT +CAKVQ+EKG+YDG+VL+AVEYEDICK++ Sbjct: 380 YRGSNARLLSVDTEKFCAKVQVEKGLYDGKVLRAVEYEDICKIS 423 >ref|NP_564690.1| DNA/RNA-binding protein Kin17 conserved region-containing protein [Arabidopsis thaliana] gi|13430440|gb|AAK25842.1|AF360132_1 unknown protein [Arabidopsis thaliana] gi|4204268|gb|AAD10649.1| Similar to Kin17 protein [Arabidopsis thaliana] gi|15293155|gb|AAK93688.1| unknown protein [Arabidopsis thaliana] gi|332195127|gb|AEE33248.1| DNA/RNA-binding protein Kin17 conserved region-containing protein [Arabidopsis thaliana] Length = 411 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = +2 Query: 2 YRGSNGRLISVDTNNYCAKVQIEKGIYDGRVLQAVEYEDICKLA 133 YRGSN RL+ VDT +CAKVQIEKG+YDGRV++++EYEDICKLA Sbjct: 368 YRGSNARLLGVDTEKFCAKVQIEKGVYDGRVIKSIEYEDICKLA 411 >ref|XP_002275968.1| PREDICTED: DNA/RNA-binding protein KIN17 [Vitis vinifera] Length = 391 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = +2 Query: 2 YRGSNGRLISVDTNNYCAKVQIEKGIYDGRVLQAVEYEDICKL 130 YRGSN RL++VDT Y AKVQIEKGIYDGRVLQAVEYEDICK+ Sbjct: 347 YRGSNARLLAVDTEKYSAKVQIEKGIYDGRVLQAVEYEDICKV 389 >gb|EAZ27541.1| hypothetical protein OsJ_11495 [Oryza sativa Japonica Group] Length = 411 Score = 77.4 bits (189), Expect = 2e-12 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = +2 Query: 2 YRGSNGRLISVDTNNYCAKVQIEKGIYDGRVLQAVEYEDICKL 130 YRGSN RL+SVDT +CAKVQ+EKG+YDG+VL+A+EYEDICK+ Sbjct: 367 YRGSNARLLSVDTERFCAKVQVEKGLYDGKVLKAIEYEDICKI 409 >gb|EAY90709.1| hypothetical protein OsI_12309 [Oryza sativa Indica Group] Length = 430 Score = 77.4 bits (189), Expect = 2e-12 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = +2 Query: 2 YRGSNGRLISVDTNNYCAKVQIEKGIYDGRVLQAVEYEDICKL 130 YRGSN RL+SVDT +CAKVQ+EKG+YDG+VL+A+EYEDICK+ Sbjct: 386 YRGSNARLLSVDTERFCAKVQVEKGLYDGKVLKAIEYEDICKI 428 >ref|NP_001050519.1| Os03g0570300 [Oryza sativa Japonica Group] gi|37700344|gb|AAR00634.1| unknown protein [Oryza sativa Japonica Group] gi|108709401|gb|ABF97196.1| KOW motif family protein, expressed [Oryza sativa Japonica Group] gi|113548990|dbj|BAF12433.1| Os03g0570300 [Oryza sativa Japonica Group] gi|215697417|dbj|BAG91411.1| unnamed protein product [Oryza sativa Japonica Group] Length = 430 Score = 77.4 bits (189), Expect = 2e-12 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = +2 Query: 2 YRGSNGRLISVDTNNYCAKVQIEKGIYDGRVLQAVEYEDICKL 130 YRGSN RL+SVDT +CAKVQ+EKG+YDG+VL+A+EYEDICK+ Sbjct: 386 YRGSNARLLSVDTERFCAKVQVEKGLYDGKVLKAIEYEDICKI 428 >ref|XP_002891834.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297337676|gb|EFH68093.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 121 Score = 77.0 bits (188), Expect = 2e-12 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = +2 Query: 2 YRGSNGRLISVDTNNYCAKVQIEKGIYDGRVLQAVEYEDICKLA 133 YRGSN +L+ VDT +CAKVQIEKG+YDGRV++++EYEDICKLA Sbjct: 78 YRGSNAKLLGVDTEKFCAKVQIEKGVYDGRVIKSIEYEDICKLA 121