BLASTX nr result
ID: Cocculus23_contig00028926
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00028926 (231 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME80501.1| hypothetical protein MYCFIDRAFT_54532 [Pseudocerc... 44 4e-09 >gb|EME80501.1| hypothetical protein MYCFIDRAFT_54532 [Pseudocercospora fijiensis CIRAD86] Length = 181 Score = 43.5 bits (101), Expect(3) = 4e-09 Identities = 24/42 (57%), Positives = 27/42 (64%) Frame = -2 Query: 128 ELHSMTIIPRPQMMLAC*R*VDRPNDRLNTADKSDGKRFPFN 3 ELHS +I R Q M+A R V+R DR NTA KS RFPFN Sbjct: 43 ELHSSGLIQRSQTMMASRRRVNRSEDRPNTAAKSGCGRFPFN 84 Score = 32.7 bits (73), Expect(3) = 4e-09 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -3 Query: 187 SNARTSPGARGISPGYNTPR 128 + ARTSPG R I+ GYNTPR Sbjct: 22 AEARTSPGTRCITRGYNTPR 41 Score = 29.6 bits (65), Expect(3) = 4e-09 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 231 RVSRRAVCNHYASILAMRGPHPG 163 RVSRRA NHYA ILA PG Sbjct: 7 RVSRRAADNHYAIILAEARTSPG 29