BLASTX nr result
ID: Cocculus23_contig00028898
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00028898 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAG49729.1| disease resistance protein [Capsicum chinense] 56 6e-06 >dbj|BAG49729.1| disease resistance protein [Capsicum chinense] Length = 1324 Score = 55.8 bits (133), Expect = 6e-06 Identities = 37/90 (41%), Positives = 55/90 (61%), Gaps = 3/90 (3%) Frame = -1 Query: 301 LTSIPD--VRGLTSLQLLVISNCPELEIVPKGFLSFLIALEELKITGCPKLKICGGFSFP 128 L S+P +R LTSLQ L+ISNCP+L+ +PK +F +L +L I CP L+ +FP Sbjct: 1202 LHSLPTEGLRHLTSLQSLLISNCPQLQSLPKS--AFPSSLSKLSINNCPNLQSLPKSAFP 1259 Query: 127 -SLQHITFSNPYSFSMLVEFGKNSNLSSLT 41 SL +T ++ + L E G S+LS+L+ Sbjct: 1260 CSLSELTITHCPNLQSLPEKGMPSSLSTLS 1289