BLASTX nr result
ID: Cocculus23_contig00028715
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00028715 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005185753.1| PREDICTED: uncharacterized protein LOC101894... 57 3e-06 >ref|XP_005185753.1| PREDICTED: uncharacterized protein LOC101894925 [Musca domestica] Length = 248 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/61 (40%), Positives = 37/61 (60%), Gaps = 2/61 (3%) Frame = -3 Query: 185 PGNCSAFFQCLNNNVWLNYCQAPLMYNHVNGFCDYAYNVRCNRSSVSLPKQKS--LVAAR 12 P +CS ++ CLN +L C ++N +N CDYA NV+C++ S LP Q S +V+ R Sbjct: 49 PYDCSKYYSCLNGLAYLRQCPGNFLWNPLNQLCDYAENVQCSQQSTELPPQPSGDIVSYR 108 Query: 11 P 9 P Sbjct: 109 P 109