BLASTX nr result
ID: Cocculus23_contig00028632
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00028632 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17075.3| unnamed protein product [Vitis vinifera] 62 1e-07 ref|XP_002270637.1| PREDICTED: dehydration-responsive element-bi... 62 1e-07 gb|AAR28674.1| CBF-like transcription factor [Vitis riparia] 60 3e-07 gb|AAR28677.1| CBF-like transcription factor [Vitis vinifera] 60 3e-07 ref|XP_006851570.1| hypothetical protein AMTR_s00040p00195730 [A... 60 4e-07 emb|CAN75246.1| hypothetical protein VITISV_027054 [Vitis vinifera] 59 5e-07 gb|AHG97393.1| C-repeat-binding transcription factor 3 [Vitis vi... 58 2e-06 ref|XP_002267961.1| PREDICTED: dehydration-responsive element-bi... 58 2e-06 gb|AAR28672.1| CBF-like transcription factor [Vitis riparia] 58 2e-06 gb|AAR28675.1| CBF-like transcription factor [Vitis riparia] 58 2e-06 gb|AAR28673.1| CBF-like transcription factor [Vitis vinifera] 58 2e-06 gb|AAR28671.1| CBF-like transcription factor [Vitis riparia] 58 2e-06 gb|ADY17812.1| CBF2 transcription factor [Vitis amurensis] 58 2e-06 gb|ADY17818.1| CBF1 transcription factor [Vitis amurensis] gi|35... 58 2e-06 gb|ACT97164.1| CBF3 [Vitis labrusca x Vitis vinifera] 58 2e-06 gb|ACD45468.1| CBF/DREB3 transcription factor [Vitis amurensis] ... 58 2e-06 gb|ABU55659.1| CBF1-like protein [Ampelopsis glandulosa var. bre... 58 2e-06 gb|ABU55658.1| CBF1-like protein [Vitis aestivalis] 58 2e-06 gb|ABU55657.1| CBF1-like protein [Vitis aestivalis] 58 2e-06 gb|ABU55656.1| CBF1-like protein [Vitis amurensis] 58 2e-06 >emb|CBI17075.3| unnamed protein product [Vitis vinifera] Length = 265 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = -3 Query: 260 EAMFNMPGLLASMAEGLLMSPPCLQSEYGWTGLDSHVDFSLWN 132 EAMFNMPGL+ SMAEGLL++PP + + W SH+D SLWN Sbjct: 173 EAMFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWN 215 >ref|XP_002270637.1| PREDICTED: dehydration-responsive element-binding protein 1D-like [Vitis vinifera] Length = 253 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = -3 Query: 260 EAMFNMPGLLASMAEGLLMSPPCLQSEYGWTGLDSHVDFSLWN 132 EAMFNMPGL+ SMAEGLL++PP + + W SH+D SLWN Sbjct: 206 EAMFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWN 248 >gb|AAR28674.1| CBF-like transcription factor [Vitis riparia] Length = 250 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -3 Query: 260 EAMFNMPGLLASMAEGLLMSPPCLQSEYGWTGLDSHVDFSLWN 132 EA+FNMPGL+ SMAEGLL++PP + + W SH+D SLWN Sbjct: 203 EAVFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWN 245 >gb|AAR28677.1| CBF-like transcription factor [Vitis vinifera] Length = 253 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -3 Query: 260 EAMFNMPGLLASMAEGLLMSPPCLQSEYGWTGLDSHVDFSLWN 132 EA+FNMPGL+ SMAEGLL++PP + + W SH+D SLWN Sbjct: 206 EAVFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWN 248 >ref|XP_006851570.1| hypothetical protein AMTR_s00040p00195730 [Amborella trichopoda] gi|548855264|gb|ERN13151.1| hypothetical protein AMTR_s00040p00195730 [Amborella trichopoda] Length = 333 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = -3 Query: 260 EAMFNMPGLLASMAEGLLMSPPCLQSEYGWTGLDSHVDFSLW 135 EA+F+MPGL+ +AEGLL++PP + + W LD+HVDF LW Sbjct: 290 EALFDMPGLITDLAEGLLITPPSFKGGFSWDDLDTHVDFELW 331 >emb|CAN75246.1| hypothetical protein VITISV_027054 [Vitis vinifera] Length = 253 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/43 (58%), Positives = 31/43 (72%) Frame = -3 Query: 260 EAMFNMPGLLASMAEGLLMSPPCLQSEYGWTGLDSHVDFSLWN 132 EA FNMPGL+ SMAEGLL++PP + + W SH+D SLWN Sbjct: 206 EAXFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWN 248 >gb|AHG97393.1| C-repeat-binding transcription factor 3 [Vitis vinifera] Length = 239 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = -3 Query: 260 EAMFNMPGLLASMAEGLLMSPPCLQSEYGWTGLDSHVDFSLWN 132 EA+FNMPGL+ SMAEGLL++PP + + W S+ D SLWN Sbjct: 195 EALFNMPGLINSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLWN 237 >ref|XP_002267961.1| PREDICTED: dehydration-responsive element-binding protein 1D [Vitis vinifera] gi|39578548|gb|AAR28676.1| CBF-like transcription factor [Vitis vinifera] Length = 239 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = -3 Query: 260 EAMFNMPGLLASMAEGLLMSPPCLQSEYGWTGLDSHVDFSLWN 132 EA+FNMPGL+ SMAEGLL++PP + + W S+ D SLWN Sbjct: 195 EALFNMPGLINSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLWN 237 >gb|AAR28672.1| CBF-like transcription factor [Vitis riparia] Length = 251 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/44 (59%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -3 Query: 260 EAMFNMPGLLASMAEGLLMSPPCLQSEYGW-TGLDSHVDFSLWN 132 EAMFNM GL+ SMAEGLL++PP + + W DSH+D SLWN Sbjct: 206 EAMFNMQGLINSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLWN 249 >gb|AAR28675.1| CBF-like transcription factor [Vitis riparia] Length = 239 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = -3 Query: 260 EAMFNMPGLLASMAEGLLMSPPCLQSEYGWTGLDSHVDFSLWN 132 EA+FNMPGL+ SMAEGLL++PP + + W S+ D SLWN Sbjct: 195 EALFNMPGLINSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLWN 237 >gb|AAR28673.1| CBF-like transcription factor [Vitis vinifera] Length = 251 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/44 (59%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -3 Query: 260 EAMFNMPGLLASMAEGLLMSPPCLQSEYGW-TGLDSHVDFSLWN 132 EAMFNM GL+ SMAEGLL++PP + + W DSH+D SLWN Sbjct: 206 EAMFNMQGLINSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLWN 249 >gb|AAR28671.1| CBF-like transcription factor [Vitis riparia] Length = 251 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/44 (59%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -3 Query: 260 EAMFNMPGLLASMAEGLLMSPPCLQSEYGW-TGLDSHVDFSLWN 132 EAMFNM GL+ SMAEGLL++PP + + W DSH+D SLWN Sbjct: 206 EAMFNMQGLINSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLWN 249 >gb|ADY17812.1| CBF2 transcription factor [Vitis amurensis] Length = 250 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = -3 Query: 260 EAMFNMPGLLASMAEGLLMSPPCLQSEYGWTGLDSHVDFSLW 135 EA+FNMPGL+ SMAEGLL++PP + + W SH+D SLW Sbjct: 203 EAVFNMPGLIDSMAEGLLLTPPAMCKGFSWDDAVSHIDLSLW 244 >gb|ADY17818.1| CBF1 transcription factor [Vitis amurensis] gi|354549083|gb|AER27641.1| AP2/ERF protein [Vitis amurensis] Length = 251 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/44 (59%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -3 Query: 260 EAMFNMPGLLASMAEGLLMSPPCLQSEYGW-TGLDSHVDFSLWN 132 EAMFNM GL+ SMAEGLL++PP + + W DSH+D SLWN Sbjct: 206 EAMFNMQGLINSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLWN 249 >gb|ACT97164.1| CBF3 [Vitis labrusca x Vitis vinifera] Length = 239 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = -3 Query: 260 EAMFNMPGLLASMAEGLLMSPPCLQSEYGWTGLDSHVDFSLWN 132 EA+FNMPGL+ SMAEGLL++PP + + W S+ D SLWN Sbjct: 195 EALFNMPGLINSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLWN 237 >gb|ACD45468.1| CBF/DREB3 transcription factor [Vitis amurensis] gi|324103757|gb|ADY17813.1| CBF3 transcription factor [Vitis amurensis] Length = 239 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = -3 Query: 260 EAMFNMPGLLASMAEGLLMSPPCLQSEYGWTGLDSHVDFSLWN 132 EA+FNMPGL+ SMAEGLL++PP + + W S+ D SLWN Sbjct: 195 EALFNMPGLINSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLWN 237 >gb|ABU55659.1| CBF1-like protein [Ampelopsis glandulosa var. brevipedunculata] Length = 247 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/44 (59%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -3 Query: 260 EAMFNMPGLLASMAEGLLMSPPCLQSEYGW-TGLDSHVDFSLWN 132 EAMFNM GL+ SMAEGLL++PP + + W DSH+D SLWN Sbjct: 202 EAMFNMQGLINSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLWN 245 >gb|ABU55658.1| CBF1-like protein [Vitis aestivalis] Length = 270 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/44 (59%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -3 Query: 260 EAMFNMPGLLASMAEGLLMSPPCLQSEYGW-TGLDSHVDFSLWN 132 EAMFNM GL+ SMAEGLL++PP + + W DSH+D SLWN Sbjct: 225 EAMFNMQGLINSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLWN 268 >gb|ABU55657.1| CBF1-like protein [Vitis aestivalis] Length = 247 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/44 (59%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -3 Query: 260 EAMFNMPGLLASMAEGLLMSPPCLQSEYGW-TGLDSHVDFSLWN 132 EAMFNM GL+ SMAEGLL++PP + + W DSH+D SLWN Sbjct: 202 EAMFNMQGLINSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLWN 245 >gb|ABU55656.1| CBF1-like protein [Vitis amurensis] Length = 247 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/44 (59%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -3 Query: 260 EAMFNMPGLLASMAEGLLMSPPCLQSEYGW-TGLDSHVDFSLWN 132 EAMFNM GL+ SMAEGLL++PP + + W DSH+D SLWN Sbjct: 202 EAMFNMQGLINSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLWN 245