BLASTX nr result
ID: Cocculus23_contig00028624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00028624 (284 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD56221.1| hypothetical protein [Cicer arietinum] 68 1e-09 ref|XP_003626141.1| RNA-binding protein [Medicago truncatula] gi... 59 9e-07 >emb|CAD56221.1| hypothetical protein [Cicer arietinum] Length = 206 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/47 (68%), Positives = 40/47 (85%) Frame = -1 Query: 143 VF*RE*FIIREDQLGRVLRISCSFYYLVASTACFVHMMKIQVIAERE 3 VF + ++I QL ++LRISCSFYYLVAS+ACFVH+MKIQV+AERE Sbjct: 1 VFLPDWYVISNHQLWKILRISCSFYYLVASSACFVHIMKIQVLAERE 47 >ref|XP_003626141.1| RNA-binding protein [Medicago truncatula] gi|355501156|gb|AES82359.1| RNA-binding protein [Medicago truncatula] Length = 454 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 95 VLRISCSFYYLVASTACFVHMMKIQVIAERE 3 +LRISCSFYYLVAS+ACFVH +KIQV+AERE Sbjct: 265 ILRISCSFYYLVASSACFVHNLKIQVLAERE 295