BLASTX nr result
ID: Cocculus23_contig00028588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00028588 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006340177.1| PREDICTED: putative cyclic nucleotide-gated ... 84 2e-14 ref|XP_004251400.1| PREDICTED: putative cyclic nucleotide-gated ... 83 5e-14 emb|CBI16330.3| unnamed protein product [Vitis vinifera] 77 3e-12 ref|XP_002282455.1| PREDICTED: putative cyclic nucleotide-gated ... 77 3e-12 ref|XP_006592705.1| PREDICTED: putative cyclic nucleotide-gated ... 74 2e-11 ref|XP_007150187.1| hypothetical protein PHAVU_005G133900g [Phas... 74 2e-11 ref|XP_004145808.1| PREDICTED: putative cyclic nucleotide-gated ... 72 1e-10 ref|XP_007016780.1| Cyclic nucleotide-gated channel 15 [Theobrom... 70 4e-10 ref|XP_006594977.1| PREDICTED: putative cyclic nucleotide-gated ... 66 6e-09 ref|XP_006594976.1| PREDICTED: putative cyclic nucleotide-gated ... 66 6e-09 ref|XP_004291702.1| PREDICTED: putative cyclic nucleotide-gated ... 65 1e-08 ref|XP_006357568.1| PREDICTED: putative cyclic nucleotide-gated ... 63 5e-08 emb|CAN61379.1| hypothetical protein VITISV_037545 [Vitis vinifera] 63 5e-08 ref|XP_007208333.1| hypothetical protein PRUPE_ppa002211mg [Prun... 62 6e-08 ref|XP_002314283.1| cyclic nucleotide-gated ion channel 15 famil... 61 1e-07 ref|XP_006488071.1| PREDICTED: putative cyclic nucleotide-gated ... 59 5e-07 ref|XP_006424547.1| hypothetical protein CICLE_v10027932mg [Citr... 59 9e-07 gb|EXB38679.1| Putative cyclic nucleotide-gated ion channel 15 [... 56 5e-06 >ref|XP_006340177.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15-like isoform X1 [Solanum tuberosum] gi|565346248|ref|XP_006340178.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15-like isoform X2 [Solanum tuberosum] gi|565346250|ref|XP_006340179.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15-like isoform X3 [Solanum tuberosum] Length = 710 Score = 84.0 bits (206), Expect = 2e-14 Identities = 40/67 (59%), Positives = 53/67 (79%) Frame = +3 Query: 153 MAYGNSRSVRFQDDLENAKFSVSKGDNVIKLTYRIDGTQIPEPSCSMKAEKMGAEKAGRS 332 MAYGNSRSVRFQDDLE+ K++ GDNVIK+ Y+IDG+++PEP+ M +M ++ G+S Sbjct: 1 MAYGNSRSVRFQDDLESTKYAAMNGDNVIKVKYKIDGSRLPEPASRM--SEMEPDRTGKS 58 Query: 333 LKVKVLS 353 LK KVLS Sbjct: 59 LKAKVLS 65 >ref|XP_004251400.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15-like [Solanum lycopersicum] Length = 707 Score = 82.8 bits (203), Expect = 5e-14 Identities = 40/67 (59%), Positives = 52/67 (77%) Frame = +3 Query: 153 MAYGNSRSVRFQDDLENAKFSVSKGDNVIKLTYRIDGTQIPEPSCSMKAEKMGAEKAGRS 332 MAYGNSRSVRFQDDLE++K++ GDNVIK+ Y IDG+++PEP+ M +M + G+S Sbjct: 1 MAYGNSRSVRFQDDLESSKYAAMNGDNVIKVKYNIDGSRLPEPASRM--SEMEPHRTGKS 58 Query: 333 LKVKVLS 353 LK KVLS Sbjct: 59 LKAKVLS 65 >emb|CBI16330.3| unnamed protein product [Vitis vinifera] Length = 697 Score = 77.0 bits (188), Expect = 3e-12 Identities = 43/67 (64%), Positives = 49/67 (73%) Frame = +3 Query: 153 MAYGNSRSVRFQDDLENAKFSVSKGDNVIKLTYRIDGTQIPEPSCSMKAEKMGAEKAGRS 332 MAY NSRSV+FQDDLE AKF + GD IK+ Y+IDGTQI E S KA K + K+GRS Sbjct: 1 MAYENSRSVKFQDDLELAKFPATNGDGKIKMKYKIDGTQIQEASYK-KAGKEVSGKSGRS 59 Query: 333 LKVKVLS 353 LK KVLS Sbjct: 60 LKAKVLS 66 >ref|XP_002282455.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15-like [Vitis vinifera] Length = 713 Score = 77.0 bits (188), Expect = 3e-12 Identities = 43/67 (64%), Positives = 49/67 (73%) Frame = +3 Query: 153 MAYGNSRSVRFQDDLENAKFSVSKGDNVIKLTYRIDGTQIPEPSCSMKAEKMGAEKAGRS 332 MAY NSRSV+FQDDLE AKF + GD IK+ Y+IDGTQI E S KA K + K+GRS Sbjct: 1 MAYENSRSVKFQDDLELAKFPATNGDGKIKMKYKIDGTQIQEASYK-KAGKEVSGKSGRS 59 Query: 333 LKVKVLS 353 LK KVLS Sbjct: 60 LKAKVLS 66 >ref|XP_006592705.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15-like [Glycine max] Length = 692 Score = 74.3 bits (181), Expect = 2e-11 Identities = 38/67 (56%), Positives = 49/67 (73%) Frame = +3 Query: 153 MAYGNSRSVRFQDDLENAKFSVSKGDNVIKLTYRIDGTQIPEPSCSMKAEKMGAEKAGRS 332 MA+GNSRS RF+DD E AKF V+ GDN K+ + IDGTQIPEPS +M +K+ AG+ Sbjct: 1 MAFGNSRSARFEDDPELAKFPVTNGDNGAKIKFHIDGTQIPEPSSNMAPKKV----AGKF 56 Query: 333 LKVKVLS 353 LK ++LS Sbjct: 57 LKTRMLS 63 >ref|XP_007150187.1| hypothetical protein PHAVU_005G133900g [Phaseolus vulgaris] gi|561023451|gb|ESW22181.1| hypothetical protein PHAVU_005G133900g [Phaseolus vulgaris] Length = 696 Score = 73.9 bits (180), Expect = 2e-11 Identities = 38/67 (56%), Positives = 46/67 (68%) Frame = +3 Query: 153 MAYGNSRSVRFQDDLENAKFSVSKGDNVIKLTYRIDGTQIPEPSCSMKAEKMGAEKAGRS 332 MA+GNSRS RF+DD E AKF S GDN K+ Y IDGTQIPEPS M +K+ G+ Sbjct: 1 MAFGNSRSARFEDDPELAKFPASNGDNGFKIKYHIDGTQIPEPSSKMAKKKV----TGKF 56 Query: 333 LKVKVLS 353 LK ++LS Sbjct: 57 LKARMLS 63 >ref|XP_004145808.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15-like [Cucumis sativus] gi|449516804|ref|XP_004165436.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15-like [Cucumis sativus] Length = 720 Score = 71.6 bits (174), Expect = 1e-10 Identities = 40/73 (54%), Positives = 47/73 (64%) Frame = +3 Query: 135 SFIQSSMAYGNSRSVRFQDDLENAKFSVSKGDNVIKLTYRIDGTQIPEPSCSMKAEKMGA 314 SF MAYG+SRSVRFQDDLE++ G V K+ Y IDGTQIPE S A + Sbjct: 15 SFENIFMAYGSSRSVRFQDDLESSALPTINGGGVTKIIYNIDGTQIPESSGKRTA---AS 71 Query: 315 EKAGRSLKVKVLS 353 K+GRSL+ KVLS Sbjct: 72 RKSGRSLRAKVLS 84 >ref|XP_007016780.1| Cyclic nucleotide-gated channel 15 [Theobroma cacao] gi|508787143|gb|EOY34399.1| Cyclic nucleotide-gated channel 15 [Theobroma cacao] Length = 708 Score = 69.7 bits (169), Expect = 4e-10 Identities = 36/67 (53%), Positives = 44/67 (65%) Frame = +3 Query: 153 MAYGNSRSVRFQDDLENAKFSVSKGDNVIKLTYRIDGTQIPEPSCSMKAEKMGAEKAGRS 332 M + SRSVRFQDDLE AK GD +IKL Y I+GTQI E S +++ + + GRS Sbjct: 1 MGFDKSRSVRFQDDLELAKLPTINGDGMIKLKYHINGTQISESSTRRPEKELPSSRTGRS 60 Query: 333 LKVKVLS 353 LK KVLS Sbjct: 61 LKTKVLS 67 >ref|XP_006594977.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15-like isoform X2 [Glycine max] Length = 630 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/67 (49%), Positives = 45/67 (67%) Frame = +3 Query: 153 MAYGNSRSVRFQDDLENAKFSVSKGDNVIKLTYRIDGTQIPEPSCSMKAEKMGAEKAGRS 332 M + NSRS F+DD E AKF + GDN +K+ + IDGTQIPEPS +M +K+ G+ Sbjct: 1 MTFANSRSASFEDDPELAKFPSTNGDNGVKIKFHIDGTQIPEPSSNMAQKKV----TGKF 56 Query: 333 LKVKVLS 353 LK ++LS Sbjct: 57 LKARMLS 63 >ref|XP_006594976.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15-like isoform X1 [Glycine max] Length = 679 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/67 (49%), Positives = 45/67 (67%) Frame = +3 Query: 153 MAYGNSRSVRFQDDLENAKFSVSKGDNVIKLTYRIDGTQIPEPSCSMKAEKMGAEKAGRS 332 M + NSRS F+DD E AKF + GDN +K+ + IDGTQIPEPS +M +K+ G+ Sbjct: 1 MTFANSRSASFEDDPELAKFPSTNGDNGVKIKFHIDGTQIPEPSSNMAQKKV----TGKF 56 Query: 333 LKVKVLS 353 LK ++LS Sbjct: 57 LKARMLS 63 >ref|XP_004291702.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15-like [Fragaria vesca subsp. vesca] Length = 704 Score = 64.7 bits (156), Expect = 1e-08 Identities = 35/67 (52%), Positives = 45/67 (67%) Frame = +3 Query: 153 MAYGNSRSVRFQDDLENAKFSVSKGDNVIKLTYRIDGTQIPEPSCSMKAEKMGAEKAGRS 332 M YGNSRSVRF+DD+E AK G +K Y+IDGTQ+ E S + + +K K+G+S Sbjct: 1 MGYGNSRSVRFEDDVELAKLPSVNGVGGVKFKYKIDGTQVQETS-TKRIDKELPGKSGKS 59 Query: 333 LKVKVLS 353 LK KVLS Sbjct: 60 LKAKVLS 66 >ref|XP_006357568.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15-like [Solanum tuberosum] Length = 710 Score = 62.8 bits (151), Expect = 5e-08 Identities = 35/67 (52%), Positives = 49/67 (73%) Frame = +3 Query: 153 MAYGNSRSVRFQDDLENAKFSVSKGDNVIKLTYRIDGTQIPEPSCSMKAEKMGAEKAGRS 332 MAYGNSRSVRFQDDLE K++ + DNVI++ +++DG + EP+ S K++K + +S Sbjct: 1 MAYGNSRSVRFQDDLEATKYAPAHEDNVIEVKHKLDGVRQSEPA-SRKSDKK-YDGGRKS 58 Query: 333 LKVKVLS 353 LK KVLS Sbjct: 59 LKSKVLS 65 >emb|CAN61379.1| hypothetical protein VITISV_037545 [Vitis vinifera] Length = 650 Score = 62.8 bits (151), Expect = 5e-08 Identities = 37/66 (56%), Positives = 44/66 (66%) Frame = +3 Query: 153 MAYGNSRSVRFQDDLENAKFSVSKGDNVIKLTYRIDGTQIPEPSCSMKAEKMGAEKAGRS 332 MAY NSRSV+FQDDLE AKF + GD IK+ Y+IDGTQI E S +K G E R Sbjct: 1 MAYENSRSVKFQDDLELAKFPATNGDGKIKMKYKIDGTQIQEAS----YKKAGKEDYER- 55 Query: 333 LKVKVL 350 +K K+L Sbjct: 56 VKQKIL 61 >ref|XP_007208333.1| hypothetical protein PRUPE_ppa002211mg [Prunus persica] gi|462403975|gb|EMJ09532.1| hypothetical protein PRUPE_ppa002211mg [Prunus persica] Length = 700 Score = 62.4 bits (150), Expect = 6e-08 Identities = 35/67 (52%), Positives = 43/67 (64%) Frame = +3 Query: 153 MAYGNSRSVRFQDDLENAKFSVSKGDNVIKLTYRIDGTQIPEPSCSMKAEKMGAEKAGRS 332 M Y NSRSVRF DD+E AK G V+K Y+IDG+Q+PE SC E+ K G+S Sbjct: 1 MGYHNSRSVRFPDDVELAKLPTINGGGVVKFKYKIDGSQVPE-SC----EEEVPGKTGKS 55 Query: 333 LKVKVLS 353 L+ KVLS Sbjct: 56 LRAKVLS 62 >ref|XP_002314283.1| cyclic nucleotide-gated ion channel 15 family protein [Populus trichocarpa] gi|222850691|gb|EEE88238.1| cyclic nucleotide-gated ion channel 15 family protein [Populus trichocarpa] Length = 745 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/67 (46%), Positives = 42/67 (62%) Frame = +3 Query: 153 MAYGNSRSVRFQDDLENAKFSVSKGDNVIKLTYRIDGTQIPEPSCSMKAEKMGAEKAGRS 332 M +GNS+SVRF+DDLE + GD IK Y IDGTQ+ + S M ++ + K G+S Sbjct: 1 MGFGNSKSVRFRDDLELSLPPAVNGDGAIKRKYNIDGTQMSDSSRKMMSQMEVSGKTGKS 60 Query: 333 LKVKVLS 353 K K+LS Sbjct: 61 FKAKILS 67 >ref|XP_006488071.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15-like [Citrus sinensis] Length = 697 Score = 59.3 bits (142), Expect = 5e-07 Identities = 36/68 (52%), Positives = 39/68 (57%), Gaps = 1/68 (1%) Frame = +3 Query: 153 MAYGNSRSVRFQDDLE-NAKFSVSKGDNVIKLTYRIDGTQIPEPSCSMKAEKMGAEKAGR 329 M Y NSRSVRFQDDLE + K GD VIK Y+ DG Q+PE S K K Sbjct: 1 MGYNNSRSVRFQDDLELSEKSPAMNGDGVIKFKYKFDGKQVPEKEVSGKPVK-------- 52 Query: 330 SLKVKVLS 353 SLK KVLS Sbjct: 53 SLKAKVLS 60 >ref|XP_006424547.1| hypothetical protein CICLE_v10027932mg [Citrus clementina] gi|557526481|gb|ESR37787.1| hypothetical protein CICLE_v10027932mg [Citrus clementina] Length = 697 Score = 58.5 bits (140), Expect = 9e-07 Identities = 36/68 (52%), Positives = 39/68 (57%), Gaps = 1/68 (1%) Frame = +3 Query: 153 MAYGNSRSVRFQDDLE-NAKFSVSKGDNVIKLTYRIDGTQIPEPSCSMKAEKMGAEKAGR 329 M Y NSRSVRFQDDLE + K GD VIK Y+ DG Q+PE S K K Sbjct: 1 MGYNNSRSVRFQDDLELSEKPPAMNGDGVIKFKYKFDGKQVPEKEVSGKPVK-------- 52 Query: 330 SLKVKVLS 353 SLK KVLS Sbjct: 53 SLKAKVLS 60 >gb|EXB38679.1| Putative cyclic nucleotide-gated ion channel 15 [Morus notabilis] Length = 701 Score = 56.2 bits (134), Expect = 5e-06 Identities = 35/77 (45%), Positives = 45/77 (58%), Gaps = 10/77 (12%) Frame = +3 Query: 153 MAYGNSRSVRFQDDLENAKFSVSKG----DNVIKLTYRIDGTQIPEPSCSMKAEKMGAE- 317 M YGNSRSVRFQDDLE A+ + G + +KL Y IDGT+IP+ + + K + E Sbjct: 1 MGYGNSRSVRFQDDLELAQLPKANGKEEEKDHVKLKYMIDGTKIPQQNTTSKKDNEDNEH 60 Query: 318 -----KAGRSLKVKVLS 353 + SLK KVLS Sbjct: 61 KEVFARRKTSLKAKVLS 77