BLASTX nr result
ID: Cocculus23_contig00028474
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00028474 (236 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007202859.1| hypothetical protein PRUPE_ppa015438mg, part... 80 2e-13 gb|AFK48041.1| unknown [Lotus japonicus] 80 4e-13 gb|EXC35250.1| hypothetical protein L484_026571 [Morus notabilis] 78 1e-12 gb|EXC35249.1| hypothetical protein L484_026570 [Morus notabilis] 78 1e-12 ref|XP_003534238.1| PREDICTED: dirigent protein 1-like [Glycine ... 78 1e-12 ref|XP_004509433.1| PREDICTED: uncharacterized protein LOC101488... 77 3e-12 ref|XP_003629142.1| Disease resistance response protein [Medicag... 77 3e-12 ref|XP_002272512.1| PREDICTED: disease resistance response prote... 77 3e-12 ref|XP_003629148.1| Disease resistance response protein [Medicag... 77 3e-12 gb|EXC35247.1| hypothetical protein L484_026568 [Morus notabilis] 76 4e-12 ref|XP_004232560.1| PREDICTED: uncharacterized protein LOC101255... 76 4e-12 ref|XP_002521711.1| Disease resistance response protein, putativ... 76 6e-12 ref|XP_007156233.1| hypothetical protein PHAVU_003G269500g [Phas... 73 5e-11 ref|XP_006387448.1| hypothetical protein POPTR_1031s00220g [Popu... 72 6e-11 ref|XP_006828709.1| hypothetical protein AMTR_s00001p00015790 [A... 72 6e-11 ref|XP_002307208.1| hypothetical protein POPTR_0005s10370g [Popu... 72 6e-11 ref|NP_001236818.1| uncharacterized protein LOC100306565 precurs... 66 4e-09 ref|XP_007157995.1| hypothetical protein PHAVU_002G115700g [Phas... 66 6e-09 ref|XP_004970808.1| PREDICTED: uncharacterized protein LOC101764... 62 6e-08 ref|NP_001144991.1| hypothetical protein precursor [Zea mays] gi... 62 6e-08 >ref|XP_007202859.1| hypothetical protein PRUPE_ppa015438mg, partial [Prunus persica] gi|462398390|gb|EMJ04058.1| hypothetical protein PRUPE_ppa015438mg, partial [Prunus persica] Length = 160 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = +1 Query: 1 GDFLFVQGYVTSSPVDLKGITVVYKIEFHLYWPPYATK 114 GDFLFVQGYVTSSPV+LKG+TVVYKIEFHLYWPPYAT+ Sbjct: 121 GDFLFVQGYVTSSPVNLKGLTVVYKIEFHLYWPPYATQ 158 >gb|AFK48041.1| unknown [Lotus japonicus] Length = 188 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 4 DFLFVQGYVTSSPVDLKGITVVYKIEFHLYWPPYATKA 117 DFLFVQGYVTSSPVDLKG+TV YKIEFHLYWPPYAT A Sbjct: 150 DFLFVQGYVTSSPVDLKGVTVTYKIEFHLYWPPYATHA 187 >gb|EXC35250.1| hypothetical protein L484_026571 [Morus notabilis] Length = 194 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 1 GDFLFVQGYVTSSPVDLKGITVVYKIEFHLYWPPYATK 114 GDF FVQGYVTSSPV+LKGITV YKIEFHLYWPPYAT+ Sbjct: 152 GDFTFVQGYVTSSPVNLKGITVTYKIEFHLYWPPYATQ 189 >gb|EXC35249.1| hypothetical protein L484_026570 [Morus notabilis] Length = 193 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 1 GDFLFVQGYVTSSPVDLKGITVVYKIEFHLYWPPYATK 114 GDF FVQGYVTSSPV+LKGITV YKIEFHLYWPPYAT+ Sbjct: 151 GDFTFVQGYVTSSPVNLKGITVTYKIEFHLYWPPYATQ 188 >ref|XP_003534238.1| PREDICTED: dirigent protein 1-like [Glycine max] Length = 186 Score = 77.8 bits (190), Expect = 1e-12 Identities = 32/38 (84%), Positives = 38/38 (100%) Frame = +1 Query: 4 DFLFVQGYVTSSPVDLKGITVVYKIEFHLYWPPYATKA 117 DF+FVQGY+++SPVDLKG+TVVYKIEFHLYWPPYAT+A Sbjct: 148 DFMFVQGYISTSPVDLKGLTVVYKIEFHLYWPPYATQA 185 >ref|XP_004509433.1| PREDICTED: uncharacterized protein LOC101488686 [Cicer arietinum] Length = 187 Score = 77.0 bits (188), Expect = 3e-12 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 4 DFLFVQGYVTSSPVDLKGITVVYKIEFHLYWPPYA 108 DF+FVQGYVTSSPVDLKGITVVYKIEFH+YWPPYA Sbjct: 149 DFMFVQGYVTSSPVDLKGITVVYKIEFHIYWPPYA 183 >ref|XP_003629142.1| Disease resistance response protein [Medicago truncatula] gi|355523164|gb|AET03618.1| Disease resistance response protein [Medicago truncatula] Length = 190 Score = 76.6 bits (187), Expect = 3e-12 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +1 Query: 4 DFLFVQGYVTSSPVDLKGITVVYKIEFHLYWPPYATKA 117 DF+FVQGYVTSSPVDLKG+TVVYKIEFH+YWPPYA ++ Sbjct: 152 DFMFVQGYVTSSPVDLKGLTVVYKIEFHIYWPPYAIQS 189 >ref|XP_002272512.1| PREDICTED: disease resistance response protein 206-like [Vitis vinifera] Length = 186 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +1 Query: 1 GDFLFVQGYVTSSPVDLKGITVVYKIEFHLYWPPYATK 114 GDF+FVQGYVTSSP+DL+G TVVYKIEFHLYWPPYA K Sbjct: 145 GDFMFVQGYVTSSPLDLQGQTVVYKIEFHLYWPPYAVK 182 >ref|XP_003629148.1| Disease resistance response protein [Medicago truncatula] gi|355523170|gb|AET03624.1| Disease resistance response protein [Medicago truncatula] Length = 190 Score = 76.6 bits (187), Expect = 3e-12 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +1 Query: 4 DFLFVQGYVTSSPVDLKGITVVYKIEFHLYWPPYATKA 117 DF+FVQGYVTSSPVDLKG+TVVYKIEFH+YWPPYA ++ Sbjct: 152 DFMFVQGYVTSSPVDLKGLTVVYKIEFHIYWPPYAIQS 189 >gb|EXC35247.1| hypothetical protein L484_026568 [Morus notabilis] Length = 194 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 1 GDFLFVQGYVTSSPVDLKGITVVYKIEFHLYWPPYATK 114 GDF FVQGYVTSSPV LKGITV YKIEFHLYWPPYAT+ Sbjct: 152 GDFTFVQGYVTSSPVILKGITVTYKIEFHLYWPPYATQ 189 >ref|XP_004232560.1| PREDICTED: uncharacterized protein LOC101255945 [Solanum lycopersicum] Length = 190 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +1 Query: 1 GDFLFVQGYVTSSPVDLKGITVVYKIEFHLYWPPYA 108 GDFLFVQGYVTSSPVDL GITV YKI+FHLYWPPYA Sbjct: 149 GDFLFVQGYVTSSPVDLSGITVTYKIQFHLYWPPYA 184 >ref|XP_002521711.1| Disease resistance response protein, putative [Ricinus communis] gi|223539102|gb|EEF40698.1| Disease resistance response protein, putative [Ricinus communis] Length = 184 Score = 75.9 bits (185), Expect = 6e-12 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +1 Query: 1 GDFLFVQGYVTSSPVDLKGITVVYKIEFHLYWPPYA 108 GDFL VQGYVTSSPVDL G+TVVYKIEFHLYWPPYA Sbjct: 143 GDFLLVQGYVTSSPVDLSGLTVVYKIEFHLYWPPYA 178 >ref|XP_007156233.1| hypothetical protein PHAVU_003G269500g [Phaseolus vulgaris] gi|561029587|gb|ESW28227.1| hypothetical protein PHAVU_003G269500g [Phaseolus vulgaris] Length = 185 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +1 Query: 4 DFLFVQGYVTSSPVDLKGITVVYKIEFHLYWPPYATKA 117 DF+FVQG VT+SPVDL G+TVVYKI+FHLYWPPYAT+A Sbjct: 147 DFMFVQGKVTTSPVDLTGLTVVYKIQFHLYWPPYATQA 184 >ref|XP_006387448.1| hypothetical protein POPTR_1031s00220g [Populus trichocarpa] gi|550307126|gb|ERP46362.1| hypothetical protein POPTR_1031s00220g [Populus trichocarpa] Length = 196 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +1 Query: 1 GDFLFVQGYVTSSPVDLKGITVVYKIEFHLYWPPYATK 114 GDF+FVQGYVTSSPVDL+G+TV YKI FHLYWP YA K Sbjct: 145 GDFMFVQGYVTSSPVDLQGLTVTYKIVFHLYWPSYANK 182 >ref|XP_006828709.1| hypothetical protein AMTR_s00001p00015790 [Amborella trichopoda] gi|548833688|gb|ERM96125.1| hypothetical protein AMTR_s00001p00015790 [Amborella trichopoda] Length = 183 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +1 Query: 4 DFLFVQGYVTSSPVDLKGITVVYKIEFHLYWPPYATKAMF 123 DF+FVQGY+ SSPVDL+GI V YK+EFHLYWPPYA+ A F Sbjct: 144 DFMFVQGYIVSSPVDLQGIDVTYKVEFHLYWPPYASFAKF 183 >ref|XP_002307208.1| hypothetical protein POPTR_0005s10370g [Populus trichocarpa] gi|222856657|gb|EEE94204.1| hypothetical protein POPTR_0005s10370g [Populus trichocarpa] Length = 196 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +1 Query: 1 GDFLFVQGYVTSSPVDLKGITVVYKIEFHLYWPPYATK 114 GDF+FVQGYVTSSPVDL+G+TV YKI FHLYWP YA K Sbjct: 145 GDFMFVQGYVTSSPVDLQGLTVTYKIVFHLYWPSYANK 182 >ref|NP_001236818.1| uncharacterized protein LOC100306565 precursor [Glycine max] gi|255628899|gb|ACU14794.1| unknown [Glycine max] Length = 195 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +1 Query: 4 DFLFVQGYVTSSPVDLKGITVVYKIEFHLYWPPYATKA 117 DFLFV GY+TS P+DLKG +VVYKI FHLYWPPY +A Sbjct: 157 DFLFVHGYITSFPIDLKGPSVVYKIGFHLYWPPYPPQA 194 >ref|XP_007157995.1| hypothetical protein PHAVU_002G115700g [Phaseolus vulgaris] gi|561031410|gb|ESW29989.1| hypothetical protein PHAVU_002G115700g [Phaseolus vulgaris] Length = 195 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 4 DFLFVQGYVTSSPVDLKGITVVYKIEFHLYWPPY 105 DFLFV GYVTSSP+D+K TVVYKI FHLYWPPY Sbjct: 157 DFLFVHGYVTSSPLDVKATTVVYKIGFHLYWPPY 190 >ref|XP_004970808.1| PREDICTED: uncharacterized protein LOC101764212 [Setaria italica] Length = 204 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +1 Query: 1 GDFLFVQGYVTSSPVDLKGITVVYKIEFHLYWPPYA 108 GDF + GYV SSPVDL+G TV YK+E HLYWPPYA Sbjct: 159 GDFAYALGYVRSSPVDLRGRTVTYKMELHLYWPPYA 194 >ref|NP_001144991.1| hypothetical protein precursor [Zea mays] gi|195649625|gb|ACG44280.1| hypothetical protein [Zea mays] gi|414879416|tpg|DAA56547.1| TPA: hypothetical protein ZEAMMB73_456451 [Zea mays] Length = 206 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +1 Query: 1 GDFLFVQGYVTSSPVDLKGITVVYKIEFHLYWPPYA 108 GDF + GYV SSPVDL+G TV YK+E HLYWPPYA Sbjct: 162 GDFAYALGYVRSSPVDLRGRTVTYKMELHLYWPPYA 197