BLASTX nr result
ID: Cocculus23_contig00027452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00027452 (563 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007029783.1| Uncharacterized protein TCM_025656 [Theobrom... 42 3e-06 ref|XP_007052567.1| Gag-pol polyprotein, putative [Theobroma cac... 42 3e-06 ref|XP_007028192.1| Uncharacterized protein TCM_023754 [Theobrom... 42 8e-06 >ref|XP_007029783.1| Uncharacterized protein TCM_025656 [Theobroma cacao] gi|508718388|gb|EOY10285.1| Uncharacterized protein TCM_025656 [Theobroma cacao] Length = 505 Score = 42.4 bits (98), Expect(2) = 3e-06 Identities = 18/30 (60%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = +2 Query: 473 KKGSEIKVNKRCLVPFKV-EKYKDEVWCFI 559 +KG+E+KV KRC V F + KY+DEVWC I Sbjct: 277 RKGNEVKVTKRCCVQFSIGNKYEDEVWCDI 306 Score = 34.7 bits (78), Expect(2) = 3e-06 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 5/47 (10%) Frame = +3 Query: 324 GRLCNVITNSGSSENTTSIDM-----LRS*GSYKPFNIQWPHKGSEI 449 G++CNVI +SGS EN + M L++ P+ +QW KG+E+ Sbjct: 236 GKVCNVIIDSGSCENVIANYMVEKLKLQTEVHPHPYKLQWLRKGNEV 282 >ref|XP_007052567.1| Gag-pol polyprotein, putative [Theobroma cacao] gi|508704828|gb|EOX96724.1| Gag-pol polyprotein, putative [Theobroma cacao] Length = 794 Score = 42.0 bits (97), Expect(2) = 3e-06 Identities = 17/28 (60%), Positives = 22/28 (78%), Gaps = 1/28 (3%) Frame = +2 Query: 473 KKGSEIKVNKRCLVPFKV-EKYKDEVWC 553 +KG+E+KV KRC V F + KY+DEVWC Sbjct: 428 RKGNEVKVTKRCCVQFSIGNKYEDEVWC 455 Score = 34.7 bits (78), Expect(2) = 3e-06 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 5/47 (10%) Frame = +3 Query: 324 GRLCNVITNSGSSENTTSIDM-----LRS*GSYKPFNIQWPHKGSEI 449 G++CNVI +SGS EN + M L++ P+ +QW KG+E+ Sbjct: 387 GKVCNVIIDSGSCENVIANYMVKKLKLQTEVHPHPYKLQWLRKGNEV 433 >ref|XP_007028192.1| Uncharacterized protein TCM_023754 [Theobroma cacao] gi|508716797|gb|EOY08694.1| Uncharacterized protein TCM_023754 [Theobroma cacao] Length = 440 Score = 42.0 bits (97), Expect(2) = 8e-06 Identities = 17/28 (60%), Positives = 22/28 (78%), Gaps = 1/28 (3%) Frame = +2 Query: 473 KKGSEIKVNKRCLVPFKV-EKYKDEVWC 553 +KG+E+KV KRC V F + KY+DEVWC Sbjct: 212 RKGNEVKVTKRCCVQFSIGSKYEDEVWC 239 Score = 33.5 bits (75), Expect(2) = 8e-06 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 5/47 (10%) Frame = +3 Query: 324 GRLCNVITNSGSSENTTSIDM-----LRS*GSYKPFNIQWPHKGSEI 449 G++CNVI +SGS EN + M L + P+ +QW KG+E+ Sbjct: 171 GKVCNVIIDSGSCENVIANYMVEKLKLPTEVHPHPYKLQWLRKGNEV 217