BLASTX nr result
ID: Cocculus23_contig00027331
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00027331 (338 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007140266.1| hypothetical protein PHAVU_008G097700g [Phas... 47 2e-07 gb|AFW86703.1| hypothetical protein ZEAMMB73_053553 [Zea mays] 46 1e-06 gb|EEC84871.1| hypothetical protein OsI_32014 [Oryza sativa Indi... 45 1e-06 sp|B7F7K7.1|BGL31_ORYSJ RecName: Full=Beta-glucosidase 31; Short... 45 1e-06 ref|NP_001063638.1| Os09g0511600 [Oryza sativa Japonica Group] g... 45 1e-06 gb|AFW86700.1| hypothetical protein ZEAMMB73_053553 [Zea mays] 46 1e-06 ref|XP_006661423.1| PREDICTED: beta-glucosidase 31-like [Oryza b... 45 1e-06 ref|XP_003575125.1| PREDICTED: beta-glucosidase 5-like isoform 2... 45 1e-06 gb|EAY97891.1| hypothetical protein OsI_19809 [Oryza sativa Indi... 45 2e-06 ref|XP_004973250.1| PREDICTED: beta-glucosidase 31-like [Setaria... 44 2e-06 gb|AAS79741.1| putative beta-glucosidase [Oryza sativa Japonica ... 45 2e-06 sp|B9FHH2.1|BGL20_ORYSJ RecName: Full=Beta-glucosidase 20; Short... 45 2e-06 dbj|BAO04180.1| hypothetical protein [Delphinium grandiflorum] 43 2e-06 ref|XP_007140262.1| hypothetical protein PHAVU_008G097300g [Phas... 46 2e-06 ref|XP_004962305.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosi... 47 3e-06 ref|XP_006654314.1| PREDICTED: beta-glucosidase 22-like [Oryza b... 47 3e-06 gb|EEE70033.1| hypothetical protein OsJ_29985 [Oryza sativa Japo... 44 4e-06 gb|EEC84872.1| hypothetical protein OsI_32015 [Oryza sativa Indi... 44 4e-06 ref|XP_006655239.1| PREDICTED: beta-glucosidase 20-like [Oryza b... 42 4e-06 ref|XP_003604720.1| Beta-glucosidase [Medicago truncatula] gi|35... 45 4e-06 >ref|XP_007140266.1| hypothetical protein PHAVU_008G097700g [Phaseolus vulgaris] gi|561013399|gb|ESW12260.1| hypothetical protein PHAVU_008G097700g [Phaseolus vulgaris] Length = 533 Score = 47.4 bits (111), Expect(2) = 2e-07 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +3 Query: 252 WFNFCCSEDFAAYADVCFKEFDDRVKHW 335 W + EDF AYADVCF+EF DRVKHW Sbjct: 178 WLSRRVVEDFTAYADVCFREFGDRVKHW 205 Score = 33.1 bits (74), Expect(2) = 2e-07 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = +2 Query: 107 LTLLSNHHDIPQSLQDEYEGYLS 175 +TLL H D+PQ+L+DEYEG+LS Sbjct: 160 VTLL--HFDLPQTLEDEYEGWLS 180 >gb|AFW86703.1| hypothetical protein ZEAMMB73_053553 [Zea mays] Length = 584 Score = 46.2 bits (108), Expect(2) = 1e-06 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = +3 Query: 270 SEDFAAYADVCFKEFDDRVKHWI 338 S+DF AYADVCF+ F DRVKHWI Sbjct: 178 SDDFTAYADVCFRSFGDRVKHWI 200 Score = 31.6 bits (70), Expect(2) = 1e-06 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +2 Query: 125 HHDIPQSLQDEYEGYLSLKFMY 190 H D+PQ+LQDEY G LS + ++ Sbjct: 141 HFDLPQALQDEYNGLLSPRIIW 162 >gb|EEC84871.1| hypothetical protein OsI_32014 [Oryza sativa Indica Group] Length = 523 Score = 45.4 bits (106), Expect(2) = 1e-06 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +3 Query: 273 EDFAAYADVCFKEFDDRVKHW 335 EDF AYADVCFK F DRVKHW Sbjct: 170 EDFTAYADVCFKNFGDRVKHW 190 Score = 32.3 bits (72), Expect(2) = 1e-06 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +2 Query: 125 HHDIPQSLQDEYEGYLSLKFM 187 H D PQ+LQDEY G LS +F+ Sbjct: 149 HFDFPQALQDEYNGILSPRFV 169 >sp|B7F7K7.1|BGL31_ORYSJ RecName: Full=Beta-glucosidase 31; Short=Os9bglu31; Flags: Precursor gi|215768376|dbj|BAH00605.1| unnamed protein product [Oryza sativa Japonica Group] gi|222641900|gb|EEE70032.1| hypothetical protein OsJ_29984 [Oryza sativa Japonica Group] Length = 523 Score = 45.4 bits (106), Expect(2) = 1e-06 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +3 Query: 273 EDFAAYADVCFKEFDDRVKHW 335 EDF AYADVCFK F DRVKHW Sbjct: 170 EDFTAYADVCFKNFGDRVKHW 190 Score = 32.3 bits (72), Expect(2) = 1e-06 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +2 Query: 125 HHDIPQSLQDEYEGYLSLKFM 187 H D PQ+LQDEY G LS +F+ Sbjct: 149 HFDFPQALQDEYNGILSPRFV 169 >ref|NP_001063638.1| Os09g0511600 [Oryza sativa Japonica Group] gi|113631871|dbj|BAF25552.1| Os09g0511600 [Oryza sativa Japonica Group] Length = 523 Score = 45.4 bits (106), Expect(2) = 1e-06 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +3 Query: 273 EDFAAYADVCFKEFDDRVKHW 335 EDF AYADVCFK F DRVKHW Sbjct: 170 EDFTAYADVCFKNFGDRVKHW 190 Score = 32.3 bits (72), Expect(2) = 1e-06 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +2 Query: 125 HHDIPQSLQDEYEGYLSLKFM 187 H D PQ+LQDEY G LS +F+ Sbjct: 149 HFDFPQALQDEYNGILSPRFV 169 >gb|AFW86700.1| hypothetical protein ZEAMMB73_053553 [Zea mays] Length = 520 Score = 46.2 bits (108), Expect(2) = 1e-06 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = +3 Query: 270 SEDFAAYADVCFKEFDDRVKHWI 338 S+DF AYADVCF+ F DRVKHWI Sbjct: 114 SDDFTAYADVCFRSFGDRVKHWI 136 Score = 31.6 bits (70), Expect(2) = 1e-06 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +2 Query: 125 HHDIPQSLQDEYEGYLSLKFMY 190 H D+PQ+LQDEY G LS + ++ Sbjct: 77 HFDLPQALQDEYNGLLSPRIIW 98 >ref|XP_006661423.1| PREDICTED: beta-glucosidase 31-like [Oryza brachyantha] Length = 516 Score = 45.4 bits (106), Expect(2) = 1e-06 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +3 Query: 273 EDFAAYADVCFKEFDDRVKHW 335 EDF AYADVCFK F DRVKHW Sbjct: 164 EDFTAYADVCFKNFGDRVKHW 184 Score = 32.3 bits (72), Expect(2) = 1e-06 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +2 Query: 125 HHDIPQSLQDEYEGYLSLKFM 187 H D PQ+LQDEY G LS +F+ Sbjct: 143 HFDFPQALQDEYNGMLSPRFI 163 >ref|XP_003575125.1| PREDICTED: beta-glucosidase 5-like isoform 2 [Brachypodium distachyon] Length = 486 Score = 45.4 bits (106), Expect(2) = 1e-06 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = +3 Query: 252 WFNFCCSEDFAAYADVCFKEFDDRVKHW 335 W + EDF AYADVCF+EF DRVK+W Sbjct: 134 WLSSRIIEDFTAYADVCFREFGDRVKYW 161 Score = 32.3 bits (72), Expect(2) = 1e-06 Identities = 14/34 (41%), Positives = 25/34 (73%) Frame = +2 Query: 86 VP*LELSLTLLSNHHDIPQSLQDEYEGYLSLKFM 187 +P +++ +TL +H D+PQ L+DEY G+LS + + Sbjct: 109 IPSIQIHITL--HHVDLPQILEDEYGGWLSSRII 140 >gb|EAY97891.1| hypothetical protein OsI_19809 [Oryza sativa Indica Group] Length = 556 Score = 45.4 bits (106), Expect(2) = 2e-06 Identities = 18/28 (64%), Positives = 20/28 (71%) Frame = +3 Query: 252 WFNFCCSEDFAAYADVCFKEFDDRVKHW 335 W N +DF AYADVCF+EF DRV HW Sbjct: 190 WINPKIVDDFTAYADVCFREFGDRVAHW 217 Score = 32.0 bits (71), Expect(2) = 2e-06 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = +2 Query: 101 LSLTLLSNHHDIPQSLQDEYEGYLSLKFM 187 + + ++ H D+PQSLQDEY G+++ K + Sbjct: 168 IQIQVVLYHSDLPQSLQDEYGGWINPKIV 196 >ref|XP_004973250.1| PREDICTED: beta-glucosidase 31-like [Setaria italica] Length = 521 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = +3 Query: 273 EDFAAYADVCFKEFDDRVKHW 335 EDF AYADVCF+ F DRVKHW Sbjct: 172 EDFTAYADVCFRSFGDRVKHW 192 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +2 Query: 125 HHDIPQSLQDEYEGYLSLKFM 187 H D+PQ+LQDEY G LS +F+ Sbjct: 151 HFDLPQALQDEYNGLLSPRFI 171 >gb|AAS79741.1| putative beta-glucosidase [Oryza sativa Japonica Group] Length = 627 Score = 45.4 bits (106), Expect(2) = 2e-06 Identities = 18/28 (64%), Positives = 20/28 (71%) Frame = +3 Query: 252 WFNFCCSEDFAAYADVCFKEFDDRVKHW 335 W N +DF AYADVCF+EF DRV HW Sbjct: 164 WINPKIVDDFTAYADVCFREFGDRVAHW 191 Score = 31.6 bits (70), Expect(2) = 2e-06 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +2 Query: 125 HHDIPQSLQDEYEGYLSLKFM 187 H D+PQSLQDEY G+++ K + Sbjct: 150 HSDLPQSLQDEYGGWINPKIV 170 >sp|B9FHH2.1|BGL20_ORYSJ RecName: Full=Beta-glucosidase 20; Short=Os5bglu20; Flags: Precursor gi|222631313|gb|EEE63445.1| hypothetical protein OsJ_18258 [Oryza sativa Japonica Group] Length = 517 Score = 45.4 bits (106), Expect(2) = 2e-06 Identities = 18/28 (64%), Positives = 20/28 (71%) Frame = +3 Query: 252 WFNFCCSEDFAAYADVCFKEFDDRVKHW 335 W N +DF AYADVCF+EF DRV HW Sbjct: 164 WINPKIVDDFTAYADVCFREFGDRVAHW 191 Score = 31.6 bits (70), Expect(2) = 2e-06 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +2 Query: 125 HHDIPQSLQDEYEGYLSLKFM 187 H D+PQSLQDEY G+++ K + Sbjct: 150 HSDLPQSLQDEYGGWINPKIV 170 >dbj|BAO04180.1| hypothetical protein [Delphinium grandiflorum] Length = 510 Score = 42.7 bits (99), Expect(2) = 2e-06 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = +3 Query: 252 WFNFCCSEDFAAYADVCFKEFDDRVKHW 335 W + +DF AYA+VCF+EF DRV HW Sbjct: 163 WLSRKIVDDFTAYAEVCFREFGDRVSHW 190 Score = 34.3 bits (77), Expect(2) = 2e-06 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 125 HHDIPQSLQDEYEGYLSLKFM 187 H+D+PQ L+DEYEG+LS K + Sbjct: 149 HYDLPQILEDEYEGWLSRKIV 169 >ref|XP_007140262.1| hypothetical protein PHAVU_008G097300g [Phaseolus vulgaris] gi|561013395|gb|ESW12256.1| hypothetical protein PHAVU_008G097300g [Phaseolus vulgaris] Length = 407 Score = 46.2 bits (108), Expect(2) = 2e-06 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +3 Query: 273 EDFAAYADVCFKEFDDRVKHW 335 EDF AYADVCF+EF DRVKHW Sbjct: 166 EDFTAYADVCFREFGDRVKHW 186 Score = 30.8 bits (68), Expect(2) = 2e-06 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = +2 Query: 107 LTLLSNHHDIPQSLQDEYEGYLSLKFM 187 +TLL H D+PQ L+DEYEG LS + + Sbjct: 141 VTLL--HLDLPQKLEDEYEGCLSRRLV 165 >ref|XP_004962305.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 22-like [Setaria italica] Length = 529 Score = 47.0 bits (110), Expect(2) = 3e-06 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +3 Query: 252 WFNFCCSEDFAAYADVCFKEFDDRVKHW 335 W + EDFAAYAD CF+EF DRVKHW Sbjct: 175 WLSPRVVEDFAAYADACFREFGDRVKHW 202 Score = 29.6 bits (65), Expect(2) = 3e-06 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = +2 Query: 95 LELSLTLLSNHHDIPQSLQDEYEGYLS 175 +E+ +TL H D PQ L+DEY G+LS Sbjct: 153 IEIHVTLY--HLDFPQILEDEYHGWLS 177 >ref|XP_006654314.1| PREDICTED: beta-glucosidase 22-like [Oryza brachyantha] Length = 524 Score = 47.0 bits (110), Expect(2) = 3e-06 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +3 Query: 252 WFNFCCSEDFAAYADVCFKEFDDRVKHW 335 W + EDF AYADVCF+EF DRVKHW Sbjct: 171 WLSPRIIEDFTAYADVCFREFGDRVKHW 198 Score = 29.6 bits (65), Expect(2) = 3e-06 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = +2 Query: 95 LELSLTLLSNHHDIPQSLQDEYEGYLS 175 +E+ +TL H D PQ L+DEY G+LS Sbjct: 149 IEIHVTLY--HLDFPQILEDEYHGWLS 173 >gb|EEE70033.1| hypothetical protein OsJ_29985 [Oryza sativa Japonica Group] Length = 665 Score = 43.9 bits (102), Expect(2) = 4e-06 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = +3 Query: 273 EDFAAYADVCFKEFDDRVKHWI 338 ED+ AYA+VCFK F DRVKHW+ Sbjct: 171 EDYTAYAEVCFKNFGDRVKHWV 192 Score = 32.3 bits (72), Expect(2) = 4e-06 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +2 Query: 125 HHDIPQSLQDEYEGYLSLKFM 187 H D+PQ+LQDEY G LS +F+ Sbjct: 150 HFDLPQALQDEYGGILSPRFI 170 >gb|EEC84872.1| hypothetical protein OsI_32015 [Oryza sativa Indica Group] Length = 665 Score = 43.9 bits (102), Expect(2) = 4e-06 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = +3 Query: 273 EDFAAYADVCFKEFDDRVKHWI 338 ED+ AYA+VCFK F DRVKHW+ Sbjct: 171 EDYTAYAEVCFKNFGDRVKHWV 192 Score = 32.3 bits (72), Expect(2) = 4e-06 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +2 Query: 125 HHDIPQSLQDEYEGYLSLKFM 187 H D+PQ+LQDEY G LS +F+ Sbjct: 150 HFDLPQALQDEYGGILSPRFI 170 >ref|XP_006655239.1| PREDICTED: beta-glucosidase 20-like [Oryza brachyantha] Length = 617 Score = 41.6 bits (96), Expect(2) = 4e-06 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = +3 Query: 252 WFNFCCSEDFAAYADVCFKEFDDRVKHW 335 W + EDFAAYA CF+EF DRV HW Sbjct: 162 WISPKFVEDFAAYAGACFREFGDRVAHW 189 Score = 34.7 bits (78), Expect(2) = 4e-06 Identities = 14/21 (66%), Positives = 18/21 (85%) Frame = +2 Query: 125 HHDIPQSLQDEYEGYLSLKFM 187 H D+PQSLQDEY G++S KF+ Sbjct: 148 HMDLPQSLQDEYGGWISPKFV 168 >ref|XP_003604720.1| Beta-glucosidase [Medicago truncatula] gi|355505775|gb|AES86917.1| Beta-glucosidase [Medicago truncatula] Length = 519 Score = 45.4 bits (106), Expect(2) = 4e-06 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = +3 Query: 252 WFNFCCSEDFAAYADVCFKEFDDRVKHW 335 W + +DF AYADVCF+EF DRVKHW Sbjct: 161 WVSRRVIKDFTAYADVCFREFGDRVKHW 188 Score = 30.8 bits (68), Expect(2) = 4e-06 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +2 Query: 122 NHHDIPQSLQDEYEGYLS 175 NH D+PQ+L+DEY G++S Sbjct: 146 NHWDLPQALEDEYGGWVS 163