BLASTX nr result
ID: Cocculus23_contig00027283
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00027283 (273 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272725.1| PREDICTED: uncharacterized protein LOC100241... 69 9e-10 ref|XP_006850285.1| hypothetical protein AMTR_s00020p00152550 [A... 60 2e-07 gb|EYU39697.1| hypothetical protein MIMGU_mgv1a024558mg, partial... 59 5e-07 >ref|XP_002272725.1| PREDICTED: uncharacterized protein LOC100241127 [Vitis vinifera] Length = 640 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/51 (54%), Positives = 42/51 (82%), Gaps = 1/51 (1%) Frame = -1 Query: 150 CPTNSVVFNSSLCACNPGYVFNSSSKACSLF-RSSSEDWLIDSGVDYSISF 1 CP+N+ +N +LC+CNPGYV N+++ ACSLF ++++ WL++SGV YSISF Sbjct: 7 CPSNAFRYNGTLCSCNPGYVLNATTGACSLFWETAADGWLVNSGVGYSISF 57 >ref|XP_006850285.1| hypothetical protein AMTR_s00020p00152550 [Amborella trichopoda] gi|548853906|gb|ERN11866.1| hypothetical protein AMTR_s00020p00152550 [Amborella trichopoda] Length = 565 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 162 LRAPCPTNSVVFNSSLCACNPGYVFNSSSKACSLF-RSSSEDWLIDSGVDYSISF 1 + PCP NS ++NSSLCACNPG+V ++S C+LF ++ +DSGV Y +F Sbjct: 1 MEPPCPQNSFLYNSSLCACNPGFVMDASRSNCTLFWLPGGAEFFVDSGVTYDHNF 55 >gb|EYU39697.1| hypothetical protein MIMGU_mgv1a024558mg, partial [Mimulus guttatus] Length = 514 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 2/48 (4%) Frame = -1 Query: 150 CPTNSVVFNSSLCACNPGYVFNSSSK--ACSLFRSSSEDWLIDSGVDY 13 CPT++ +FN++ CACNPGY+FNSSS +CSLF ++ + SGVDY Sbjct: 3 CPTHAFIFNATQCACNPGYLFNSSSSSTSCSLFAATGPAVELSSGVDY 50