BLASTX nr result
ID: Cocculus23_contig00027247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00027247 (456 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006303549.1| hypothetical protein CARUB_v10011006mg [Caps... 56 5e-06 ref|NP_173207.1| pentatricopeptide repeat-containing protein [Ar... 55 8e-06 >ref|XP_006303549.1| hypothetical protein CARUB_v10011006mg [Capsella rubella] gi|482572260|gb|EOA36447.1| hypothetical protein CARUB_v10011006mg [Capsella rubella] Length = 728 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/59 (40%), Positives = 38/59 (64%) Frame = -3 Query: 181 LCCNISHSIDYARRDVGEELHGYVVKMGFSERVIVQTALIDMYCPCGLSNCGRQVFDRI 5 +CC +S + ++G E+HG+VV+ S+ ++VQ AL++MY CGL N G VF+ I Sbjct: 437 ICCILSICAELPALNLGREIHGHVVRTSMSDNILVQNALVNMYTKCGLLNEGSLVFEAI 495 >ref|NP_173207.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75175206|sp|Q9LNP2.1|PPR47_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At1g17630 gi|8778465|gb|AAF79473.1|AC022492_17 F1L3.33 [Arabidopsis thaliana] gi|332191495|gb|AEE29616.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 731 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/59 (38%), Positives = 38/59 (64%) Frame = -3 Query: 181 LCCNISHSIDYARRDVGEELHGYVVKMGFSERVIVQTALIDMYCPCGLSNCGRQVFDRI 5 +CC +S + ++G E+HG+V++ SE ++VQ AL++MY CGL + G VF+ I Sbjct: 437 ICCILSICAELPALNLGREIHGHVIRTSMSENILVQNALVNMYAKCGLLSEGSLVFEAI 495