BLASTX nr result
ID: Cocculus23_contig00026792
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00026792 (253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006579168.1| PREDICTED: uncharacterized protein LOC102668... 60 3e-07 ref|XP_006605118.1| PREDICTED: uncharacterized protein LOC102669... 56 4e-06 >ref|XP_006579168.1| PREDICTED: uncharacterized protein LOC102668417 [Glycine max] Length = 210 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = +3 Query: 3 KNISDEEVMEKILCTLDPKFECIVVTIEETKDLELMTIEHQMGSL 137 K + D +MEKILC+LDPKF+ IVVTIEETK LE M IE GSL Sbjct: 151 KKLEDVRIMEKILCSLDPKFKHIVVTIEETKYLETMMIEQLQGSL 195 >ref|XP_006605118.1| PREDICTED: uncharacterized protein LOC102669108 [Glycine max] Length = 218 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = +3 Query: 3 KNISDEEVMEKILCTLDPKFECIVVTIEETKDLELMTIEHQMGSL 137 + + D ++MEKIL +LDPK+E IV IEET+DLE MTIE +GSL Sbjct: 131 EKLDDVKIMEKILRSLDPKYEHIVTIIEETRDLEAMTIEQLLGSL 175