BLASTX nr result
ID: Cocculus23_contig00026465
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00026465 (468 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006485285.1| PREDICTED: phosphoglucan phosphatase DSP4, c... 59 7e-07 ref|XP_006485283.1| PREDICTED: phosphoglucan phosphatase DSP4, c... 59 7e-07 ref|XP_006436563.1| hypothetical protein CICLE_v10031853mg [Citr... 59 7e-07 gb|AFK40034.1| unknown [Lotus japonicus] 56 5e-06 >ref|XP_006485285.1| PREDICTED: phosphoglucan phosphatase DSP4, chloroplastic-like isoform X3 [Citrus sinensis] Length = 356 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 172 VFPIQKLPFARYFGVDIIAIQEYAKQYNDIQHIRAEIR 59 +F +Q+ P YFGVDIIAIQEYAK Y+DIQHIRAEIR Sbjct: 126 IFCLQQDPDLEYFGVDIIAIQEYAKTYDDIQHIRAEIR 163 >ref|XP_006485283.1| PREDICTED: phosphoglucan phosphatase DSP4, chloroplastic-like isoform X1 [Citrus sinensis] gi|568863729|ref|XP_006485284.1| PREDICTED: phosphoglucan phosphatase DSP4, chloroplastic-like isoform X2 [Citrus sinensis] Length = 376 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 172 VFPIQKLPFARYFGVDIIAIQEYAKQYNDIQHIRAEIR 59 +F +Q+ P YFGVDIIAIQEYAK Y+DIQHIRAEIR Sbjct: 126 IFCLQQDPDLEYFGVDIIAIQEYAKTYDDIQHIRAEIR 163 >ref|XP_006436563.1| hypothetical protein CICLE_v10031853mg [Citrus clementina] gi|567888084|ref|XP_006436564.1| hypothetical protein CICLE_v10031853mg [Citrus clementina] gi|557538759|gb|ESR49803.1| hypothetical protein CICLE_v10031853mg [Citrus clementina] gi|557538760|gb|ESR49804.1| hypothetical protein CICLE_v10031853mg [Citrus clementina] Length = 340 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 172 VFPIQKLPFARYFGVDIIAIQEYAKQYNDIQHIRAEIR 59 +F +Q+ P YFGVDIIAIQEYAK Y+DIQHIRAEIR Sbjct: 90 IFCLQQDPDLEYFGVDIIAIQEYAKTYDDIQHIRAEIR 127 >gb|AFK40034.1| unknown [Lotus japonicus] Length = 382 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 172 VFPIQKLPFARYFGVDIIAIQEYAKQYNDIQHIRAEIR 59 +F +Q+ P YFGVDI AIQEYAK +NDIQH+RAEIR Sbjct: 131 IFCLQQNPDLEYFGVDIKAIQEYAKTFNDIQHLRAEIR 168