BLASTX nr result
ID: Cocculus23_contig00026284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00026284 (612 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB75140.1| hypothetical protein L484_025916 [Morus notabilis] 57 4e-06 >gb|EXB75140.1| hypothetical protein L484_025916 [Morus notabilis] Length = 70 Score = 57.0 bits (136), Expect = 4e-06 Identities = 33/75 (44%), Positives = 42/75 (56%) Frame = -3 Query: 454 MGMVVVXXXXXXXXXXXXXXGCYFLGRAKGRQDVRTNAQVFXXXXXXXXXXXXVFSHPSP 275 MGMVVV GCYFLGRA+GRQDVRTNAQ++ PSP Sbjct: 1 MGMVVVISLPLILFCLLLGFGCYFLGRARGRQDVRTNAQIYGVPAPPPGAAN---PFPSP 57 Query: 274 PPTHTKQDGHLSTNI 230 PP+H+K ++S+N+ Sbjct: 58 PPSHSKP--NISSNV 70