BLASTX nr result
ID: Cocculus23_contig00024477
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00024477 (523 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003602761.1| NAD(P)H-quinone oxidoreductase chain [Medica... 60 3e-07 ref|XP_002517186.1| short-chain dehydrogenase, putative [Ricinus... 59 5e-07 ref|XP_006489323.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketodihydr... 57 4e-06 ref|XP_006419849.1| hypothetical protein CICLE_v10005413mg [Citr... 57 4e-06 ref|XP_006378676.1| hypothetical protein POPTR_0010s199201g, par... 57 4e-06 ref|XP_006407987.1| hypothetical protein EUTSA_v10021124mg [Eutr... 56 6e-06 ref|XP_004486137.1| PREDICTED: 3-ketodihydrosphingosine reductas... 56 6e-06 ref|XP_007208623.1| hypothetical protein PRUPE_ppa021089mg [Prun... 56 6e-06 >ref|XP_003602761.1| NAD(P)H-quinone oxidoreductase chain [Medicago truncatula] gi|355491809|gb|AES73012.1| NAD(P)H-quinone oxidoreductase chain [Medicago truncatula] Length = 538 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 3 MLAFVEVIAAGLMRVVALFFQWNWYESIAKWSNQKK 110 ++AFVEVIAAG+MR+ AL FQWNWY SI KW Q+K Sbjct: 425 LMAFVEVIAAGIMRIAALCFQWNWYGSIEKWHKQRK 460 >ref|XP_002517186.1| short-chain dehydrogenase, putative [Ricinus communis] gi|223543821|gb|EEF45349.1| short-chain dehydrogenase, putative [Ricinus communis] Length = 456 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +3 Query: 6 LAFVEVIAAGLMRVVALFFQWNWYESIAKWSNQKK 110 +AFVEV+AAGL+R+VAL FQWNWY SI KW QKK Sbjct: 292 MAFVEVVAAGLIRLVALCFQWNWYGSIEKWHAQKK 326 >ref|XP_006489323.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketodihydrosphingosine reductase-like [Citrus sinensis] Length = 330 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 3 MLAFVEVIAAGLMRVVALFFQWNWYESIAKWSNQKK 110 ++AFVEV+AAGL+R VAL FQWNWY SI KW Q K Sbjct: 288 LMAFVEVVAAGLIRFVALCFQWNWYGSIEKWHAQGK 323 >ref|XP_006419849.1| hypothetical protein CICLE_v10005413mg [Citrus clementina] gi|557521722|gb|ESR33089.1| hypothetical protein CICLE_v10005413mg [Citrus clementina] Length = 327 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 3 MLAFVEVIAAGLMRVVALFFQWNWYESIAKWSNQKK 110 ++AFVEV+AAGL+R VAL FQWNWY SI KW Q K Sbjct: 288 LMAFVEVVAAGLIRFVALCFQWNWYGSIEKWHAQGK 323 >ref|XP_006378676.1| hypothetical protein POPTR_0010s199201g, partial [Populus trichocarpa] gi|550330197|gb|ERP56473.1| hypothetical protein POPTR_0010s199201g, partial [Populus trichocarpa] Length = 98 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = +3 Query: 3 MLAFVEVIAAGLMRVVALFFQWNWYESIAKWSNQK 107 ++AFVEV+AAG++R+ AL FQWNWY SI KW QK Sbjct: 61 LMAFVEVVAAGIVRIAALCFQWNWYGSIEKWHMQK 95 >ref|XP_006407987.1| hypothetical protein EUTSA_v10021124mg [Eutrema salsugineum] gi|557109133|gb|ESQ49440.1| hypothetical protein EUTSA_v10021124mg [Eutrema salsugineum] Length = 328 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +3 Query: 6 LAFVEVIAAGLMRVVALFFQWNWYESIAKWSNQK 107 LAF+EVI AG +R++ALFFQW+WY +IAKWS K Sbjct: 291 LAFLEVITAGPIRLIALFFQWDWYNAIAKWSKTK 324 >ref|XP_004486137.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Cicer arietinum] Length = 327 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/36 (58%), Positives = 29/36 (80%) Frame = +3 Query: 3 MLAFVEVIAAGLMRVVALFFQWNWYESIAKWSNQKK 110 ++AFVEV+ AG++R+ AL FQWNWY SI KW ++K Sbjct: 286 LMAFVEVVTAGILRIAALCFQWNWYGSIEKWHKERK 321 >ref|XP_007208623.1| hypothetical protein PRUPE_ppa021089mg [Prunus persica] gi|462404265|gb|EMJ09822.1| hypothetical protein PRUPE_ppa021089mg [Prunus persica] Length = 473 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = +3 Query: 3 MLAFVEVIAAGLMRVVALFFQWNWYESIAKWSNQKK 110 ++AFVEV+AAGL+R+VALFFQWNWY I W Q + Sbjct: 290 VMAFVEVVAAGLVRLVALFFQWNWYNGIHMWHAQNE 325