BLASTX nr result
ID: Cocculus23_contig00024323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00024323 (261 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265720.2| PREDICTED: putative pentatricopeptide repeat... 68 2e-09 emb|CBI29414.3| unnamed protein product [Vitis vinifera] 68 2e-09 ref|XP_004306318.1| PREDICTED: pentatricopeptide repeat-containi... 66 4e-09 dbj|BAB62625.1| P0402A09.8 [Oryza sativa Japonica Group] gi|2080... 66 6e-09 ref|XP_007161642.1| hypothetical protein PHAVU_001G086300g [Phas... 65 8e-09 ref|XP_003624481.1| Pentatricopeptide repeat-containing protein ... 65 8e-09 ref|XP_006338733.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_006338732.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_004170996.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_004143694.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_003552616.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_006644243.1| PREDICTED: putative pentatricopeptide repeat... 64 2e-08 ref|XP_006644241.1| PREDICTED: putative pentatricopeptide repeat... 64 2e-08 ref|XP_006643626.1| PREDICTED: putative pentatricopeptide repeat... 64 2e-08 ref|XP_006440836.1| hypothetical protein CICLE_v10018700mg [Citr... 64 2e-08 ref|XP_004967899.1| PREDICTED: putative pentatricopeptide repeat... 64 2e-08 ref|XP_007033247.1| Mitochondrial editing factor 22 [Theobroma c... 64 2e-08 ref|XP_004308731.1| PREDICTED: putative pentatricopeptide repeat... 64 2e-08 ref|XP_004304934.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 dbj|BAD45498.1| hypothetical protein [Oryza sativa Japonica Grou... 64 2e-08 >ref|XP_002265720.2| PREDICTED: putative pentatricopeptide repeat-containing protein At3g25060, mitochondrial-like [Vitis vinifera] Length = 678 Score = 67.8 bits (164), Expect = 2e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 260 ISKIANREIVVRDMKRFHHFKDGVCSCGDFW 168 ISKI NREIVVRD+KRFHHFKDGVCSCGD+W Sbjct: 648 ISKIVNREIVVRDVKRFHHFKDGVCSCGDYW 678 >emb|CBI29414.3| unnamed protein product [Vitis vinifera] Length = 350 Score = 67.8 bits (164), Expect = 2e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 260 ISKIANREIVVRDMKRFHHFKDGVCSCGDFW 168 ISKI NREIVVRD+KRFHHFKDGVCSCGD+W Sbjct: 320 ISKIVNREIVVRDVKRFHHFKDGVCSCGDYW 350 >ref|XP_004306318.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 747 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 260 ISKIANREIVVRDMKRFHHFKDGVCSCGDFW 168 ISK+ NREIVVRD KRFHHFKDG+CSCGDFW Sbjct: 717 ISKVMNREIVVRDSKRFHHFKDGLCSCGDFW 747 >dbj|BAB62625.1| P0402A09.8 [Oryza sativa Japonica Group] gi|20804430|dbj|BAB92127.1| P0455C04.2 [Oryza sativa Japonica Group] Length = 1122 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/52 (55%), Positives = 40/52 (76%) Frame = -2 Query: 260 ISKIANREIVVRDMKRFHHFKDGVCSCGDFW*LYAQYMQCEIFGEYATSAIA 105 ISKI NR+I+VRD +RFHHFKDGVCSCGD+W + MQ ++ + AT+ ++ Sbjct: 780 ISKIVNRDIIVRDSRRFHHFKDGVCSCGDYW---ERSMQVQMQMQQATTVLS 828 >ref|XP_007161642.1| hypothetical protein PHAVU_001G086300g [Phaseolus vulgaris] gi|561035106|gb|ESW33636.1| hypothetical protein PHAVU_001G086300g [Phaseolus vulgaris] Length = 669 Score = 65.5 bits (158), Expect = 8e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 260 ISKIANREIVVRDMKRFHHFKDGVCSCGDFW 168 ISK+ NREIVVRD KRFHHFKDG+CSCGD+W Sbjct: 639 ISKVVNREIVVRDSKRFHHFKDGMCSCGDYW 669 >ref|XP_003624481.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|87240699|gb|ABD32557.1| Tetratricopeptide-like helical [Medicago truncatula] gi|355499496|gb|AES80699.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 672 Score = 65.5 bits (158), Expect = 8e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 260 ISKIANREIVVRDMKRFHHFKDGVCSCGDFW 168 ISKI NREIV+RD KRFHHFKDG+CSCGD+W Sbjct: 642 ISKIVNREIVIRDSKRFHHFKDGLCSCGDYW 672 >ref|XP_006338733.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like isoform X2 [Solanum tuberosum] Length = 619 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 260 ISKIANREIVVRDMKRFHHFKDGVCSCGDFW 168 ISKI NREIVVRD KRFHHFKDG CSCGD+W Sbjct: 589 ISKIVNREIVVRDAKRFHHFKDGSCSCGDYW 619 >ref|XP_006338732.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like isoform X1 [Solanum tuberosum] Length = 645 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 260 ISKIANREIVVRDMKRFHHFKDGVCSCGDFW 168 ISKI NREIVVRD KRFHHFKDG CSCGD+W Sbjct: 615 ISKIVNREIVVRDAKRFHHFKDGSCSCGDYW 645 >ref|XP_004170996.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like, partial [Cucumis sativus] Length = 658 Score = 64.7 bits (156), Expect = 1e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 260 ISKIANREIVVRDMKRFHHFKDGVCSCGDFW 168 ISK+ +REI++RD KRFHHFKDGVCSCGDFW Sbjct: 628 ISKLVDREIIIRDAKRFHHFKDGVCSCGDFW 658 >ref|XP_004143694.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Cucumis sativus] Length = 673 Score = 64.7 bits (156), Expect = 1e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 260 ISKIANREIVVRDMKRFHHFKDGVCSCGDFW 168 ISK+ +REI++RD KRFHHFKDGVCSCGDFW Sbjct: 643 ISKLVDREIIIRDAKRFHHFKDGVCSCGDFW 673 >ref|XP_003552616.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Glycine max] Length = 658 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 260 ISKIANREIVVRDMKRFHHFKDGVCSCGDFW 168 ISK ANREI+VRD+ RFHHFKDGVCSCGD+W Sbjct: 628 ISKFANREILVRDVNRFHHFKDGVCSCGDYW 658 >ref|XP_006644243.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510-like isoform X3 [Oryza brachyantha] Length = 514 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 260 ISKIANREIVVRDMKRFHHFKDGVCSCGDFW 168 ISKI NR+I+VRD +RFHHFKDGVCSCGD+W Sbjct: 484 ISKIVNRDIIVRDSRRFHHFKDGVCSCGDYW 514 >ref|XP_006644241.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510-like isoform X1 [Oryza brachyantha] gi|573913107|ref|XP_006644242.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510-like isoform X2 [Oryza brachyantha] Length = 543 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 260 ISKIANREIVVRDMKRFHHFKDGVCSCGDFW 168 ISKI NR+I+VRD +RFHHFKDGVCSCGD+W Sbjct: 513 ISKIVNRDIIVRDSRRFHHFKDGVCSCGDYW 543 >ref|XP_006643626.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510-like [Oryza brachyantha] Length = 543 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 260 ISKIANREIVVRDMKRFHHFKDGVCSCGDFW 168 ISKI NR+I+VRD +RFHHFKDGVCSCGD+W Sbjct: 513 ISKIVNRDIIVRDSRRFHHFKDGVCSCGDYW 543 >ref|XP_006440836.1| hypothetical protein CICLE_v10018700mg [Citrus clementina] gi|557543098|gb|ESR54076.1| hypothetical protein CICLE_v10018700mg [Citrus clementina] Length = 980 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 260 ISKIANREIVVRDMKRFHHFKDGVCSCGDFW 168 ISK+A REIVVRD KRFHHF+DGVCSCGD+W Sbjct: 950 ISKVAEREIVVRDNKRFHHFRDGVCSCGDYW 980 >ref|XP_004967899.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510-like [Setaria italica] Length = 615 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 260 ISKIANREIVVRDMKRFHHFKDGVCSCGDFW 168 ISKI +REI+VRD KRFHHFKDG+CSCGD+W Sbjct: 585 ISKIVDREIIVRDSKRFHHFKDGICSCGDYW 615 >ref|XP_007033247.1| Mitochondrial editing factor 22 [Theobroma cacao] gi|508712276|gb|EOY04173.1| Mitochondrial editing factor 22 [Theobroma cacao] Length = 735 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 260 ISKIANREIVVRDMKRFHHFKDGVCSCGDFW 168 ISK+ NREIVVRD RFHHFKDGVCSCGD+W Sbjct: 705 ISKLVNREIVVRDANRFHHFKDGVCSCGDYW 735 >ref|XP_004308731.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142-like [Fragaria vesca subsp. vesca] Length = 675 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 260 ISKIANREIVVRDMKRFHHFKDGVCSCGDFW 168 ISKIA REIVVRD RFHHFKDGVCSCGD+W Sbjct: 645 ISKIAEREIVVRDTNRFHHFKDGVCSCGDYW 675 >ref|XP_004304934.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Fragaria vesca subsp. vesca] Length = 739 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 260 ISKIANREIVVRDMKRFHHFKDGVCSCGDFW 168 ISK+ NREIVVRD KRFHHFKDG CSCGD+W Sbjct: 709 ISKLVNREIVVRDAKRFHHFKDGFCSCGDYW 739 >dbj|BAD45498.1| hypothetical protein [Oryza sativa Japonica Group] gi|218187337|gb|EEC69764.1| hypothetical protein OsI_00012 [Oryza sativa Indica Group] Length = 810 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 260 ISKIANREIVVRDMKRFHHFKDGVCSCGDFW 168 ISKI NR+I+VRD +RFHHFKDGVCSCGD+W Sbjct: 780 ISKIVNRDIIVRDSRRFHHFKDGVCSCGDYW 810