BLASTX nr result
ID: Cocculus23_contig00024132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00024132 (225 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_740694.1| hypothetical chloroplast RF2 [Nandina domestica... 45 2e-07 ref|YP_001004228.1| hypothetical chloroplast RF2 [Ranunculus mac... 44 2e-07 ref|YP_001294142.1| hypothetical chloroplast RF2 [Chloranthus sp... 44 6e-07 gb|AEK78165.1| hypothetical chloroplast RF2 [Sarcandra chloranth... 44 6e-07 gb|AEK78147.1| hypothetical chloroplast RF2 [Canella winterana] 41 1e-06 ref|YP_008993649.1| hypothetical chloroplast RF21 (chloroplast) ... 41 1e-06 ref|YP_008993391.1| hypothetical chloroplast RF21 (chloroplast) ... 41 1e-06 ref|YP_008993219.1| hypothetical chloroplast RF21 (chloroplast) ... 41 1e-06 gb|AEX99130.1| hypothetical chloroplast RF2 (chloroplast) [Magno... 41 1e-06 ref|YP_007474579.1| hypothetical chloroplast RF2 (chloroplast) [... 41 1e-06 gb|AEX98795.1| hypothetical chloroplast RF2-like protein (chloro... 41 1e-06 gb|AEX98728.1| hypothetical chloroplast RF2 (chloroplast) [Magno... 41 1e-06 gb|AEX98711.1| hypothetical chloroplast RF2 (chloroplast) [Magno... 41 1e-06 ref|YP_007474495.1| hypothetical chloroplast RF2 (chloroplast) [... 41 1e-06 ref|YP_007474412.1| hypothetical chloroplast RF2 (chloroplast) [... 41 1e-06 ref|YP_004769757.1| hypothetical chloroplast RF21 [Magnolia kwan... 41 1e-06 ref|YP_740245.1| hypothetical chloroplast RF2 [Liriodendron tuli... 41 1e-06 ref|NP_904142.1| Ycf2 [Amborella trichopoda] gi|34500977|ref|NP_... 41 1e-06 ref|YP_001294228.1| hypothetical chloroplast RF2 [Buxus microphy... 46 3e-06 ref|YP_008993821.1| hypothetical chloroplast RF21 (chloroplast) ... 41 4e-06 >ref|YP_740694.1| hypothetical chloroplast RF2 [Nandina domestica] gi|114330032|ref|YP_740713.1| hypothetical chloroplast RF2 [Nandina domestica] gi|122165906|sp|Q09FP8.1|YCF2_NANDO RecName: Full=Protein Ycf2 gi|114054515|gb|ABI49908.1| hypothetical chloroplast RF2 [Nandina domestica] gi|114054534|gb|ABI49927.1| hypothetical chloroplast RF2 [Nandina domestica] Length = 2299 Score = 45.4 bits (106), Expect(2) = 2e-07 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = +3 Query: 60 KCLHYLILAEERILQNPNNESPVPFIWAYLRS 155 KCLH L+L+EE I +N NESP+P IWA+LRS Sbjct: 1307 KCLHNLLLSEEMIRRN--NESPIPLIWAHLRS 1336 Score = 35.4 bits (80), Expect(2) = 2e-07 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +2 Query: 2 QKKLCAILPQWNLISEIST 58 QKKL ILPQWNLISEIS+ Sbjct: 1288 QKKLWVILPQWNLISEISS 1306 >ref|YP_001004228.1| hypothetical chloroplast RF2 [Ranunculus macranthus] gi|122894049|ref|YP_001004245.1| hypothetical chloroplast RF2 [Ranunculus macranthus] gi|205413370|sp|A1XGT0.1|YCF2_RANMC RecName: Full=Protein Ycf2 gi|85540846|gb|ABC70798.1| hypothetical chloroplast RF2 [Ranunculus macranthus] gi|85540863|gb|ABC70815.1| hypothetical chloroplast RF2 [Ranunculus macranthus] Length = 2294 Score = 43.9 bits (102), Expect(2) = 2e-07 Identities = 24/45 (53%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +3 Query: 60 KCLHYLILAEERILQNPNNESPVPFIWAYLRS---LSLSFHVSFF 185 KCLH L+L+EE I ++ NESPVP IWA+LRS L + + FF Sbjct: 1300 KCLHDLLLSEETIRRH--NESPVPLIWAHLRSPNARELLYSILFF 1342 Score = 37.0 bits (84), Expect(2) = 2e-07 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +2 Query: 2 QKKLCAILPQWNLISEIST 58 QKKL AILPQWNLISEIS+ Sbjct: 1281 QKKLWAILPQWNLISEISS 1299 >ref|YP_001294142.1| hypothetical chloroplast RF2 [Chloranthus spicatus] gi|149390329|ref|YP_001294160.1| hypothetical chloroplast RF2 [Chloranthus spicatus] gi|205412867|sp|A6MMG6.1|YCF2_CHLSC RecName: Full=Protein Ycf2 gi|146744231|gb|ABQ43303.1| hypothetical chloroplast RF2 [Chloranthus spicatus] gi|146744249|gb|ABQ43321.1| hypothetical chloroplast RF2 [Chloranthus spicatus] Length = 2321 Score = 43.5 bits (101), Expect(2) = 6e-07 Identities = 21/32 (65%), Positives = 25/32 (78%) Frame = +3 Query: 60 KCLHYLILAEERILQNPNNESPVPFIWAYLRS 155 KCL L+L+EERI +N NESPVP IW +LRS Sbjct: 1312 KCLQNLLLSEERIRRN--NESPVPLIWTHLRS 1341 Score = 35.4 bits (80), Expect(2) = 6e-07 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +2 Query: 2 QKKLCAILPQWNLISEIST 58 QKKL ILPQWNLISEIS+ Sbjct: 1293 QKKLWVILPQWNLISEISS 1311 >gb|AEK78165.1| hypothetical chloroplast RF2 [Sarcandra chloranthoides] Length = 2315 Score = 43.5 bits (101), Expect(2) = 6e-07 Identities = 21/32 (65%), Positives = 25/32 (78%) Frame = +3 Query: 60 KCLHYLILAEERILQNPNNESPVPFIWAYLRS 155 KCL L+L+EERI +N NESPVP IW +LRS Sbjct: 1314 KCLQNLLLSEERIRRN--NESPVPLIWTHLRS 1343 Score = 35.4 bits (80), Expect(2) = 6e-07 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +2 Query: 2 QKKLCAILPQWNLISEIST 58 QKKL ILPQWNLISEIS+ Sbjct: 1295 QKKLWVILPQWNLISEISS 1313 >gb|AEK78147.1| hypothetical chloroplast RF2 [Canella winterana] Length = 2311 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +3 Query: 60 KCLHYLILAEERILQNPNNESPVPFIWAYLRS 155 KCL L+L+EE I + NNESPVP IW +LRS Sbjct: 1323 KCLQNLLLSEEMI--HRNNESPVPLIWTHLRS 1352 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +2 Query: 2 QKKLCAILPQWNLISEIST 58 QKKL AILPQWNLISEIS+ Sbjct: 1304 QKKLWAILPQWNLISEISS 1322 >ref|YP_008993649.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia odora] gi|570760248|ref|YP_008993668.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia odora] Length = 2298 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +3 Query: 60 KCLHYLILAEERILQNPNNESPVPFIWAYLRS 155 KCL L+L+EE I + NNESPVP IW +LRS Sbjct: 1309 KCLQNLLLSEEMI--HRNNESPVPLIWTHLRS 1338 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +2 Query: 2 QKKLCAILPQWNLISEIST 58 QKKL AILPQWNLISEIS+ Sbjct: 1290 QKKLWAILPQWNLISEISS 1308 >ref|YP_008993391.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia pyramidata] gi|570759987|ref|YP_008993410.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia pyramidata] Length = 2298 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +3 Query: 60 KCLHYLILAEERILQNPNNESPVPFIWAYLRS 155 KCL L+L+EE I + NNESPVP IW +LRS Sbjct: 1309 KCLQNLLLSEEMI--HRNNESPVPLIWTHLRS 1338 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +2 Query: 2 QKKLCAILPQWNLISEIST 58 QKKL AILPQWNLISEIS+ Sbjct: 1290 QKKLWAILPQWNLISEISS 1308 >ref|YP_008993219.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia cathcartii] gi|570759813|ref|YP_008993238.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia cathcartii] Length = 2298 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +3 Query: 60 KCLHYLILAEERILQNPNNESPVPFIWAYLRS 155 KCL L+L+EE I + NNESPVP IW +LRS Sbjct: 1309 KCLQNLLLSEEMI--HRNNESPVPLIWTHLRS 1338 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +2 Query: 2 QKKLCAILPQWNLISEIST 58 QKKL AILPQWNLISEIS+ Sbjct: 1290 QKKLWAILPQWNLISEISS 1308 >gb|AEX99130.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia grandiflora] Length = 2298 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +3 Query: 60 KCLHYLILAEERILQNPNNESPVPFIWAYLRS 155 KCL L+L+EE I + NNESPVP IW +LRS Sbjct: 1309 KCLQNLLLSEEMI--HRNNESPVPLIWTHLRS 1338 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +2 Query: 2 QKKLCAILPQWNLISEIST 58 QKKL AILPQWNLISEIS+ Sbjct: 1290 QKKLWAILPQWNLISEISS 1308 >ref|YP_007474579.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia grandiflora] gi|452848915|ref|YP_007474596.1| photosystem I assembly protein Ycf2 (chloroplast) [Magnolia grandiflora] gi|372862885|gb|AEX98961.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia grandiflora] gi|372862902|gb|AEX98978.1| photosystem I assembly protein Ycf2 (chloroplast) [Magnolia grandiflora] Length = 2298 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +3 Query: 60 KCLHYLILAEERILQNPNNESPVPFIWAYLRS 155 KCL L+L+EE I + NNESPVP IW +LRS Sbjct: 1309 KCLQNLLLSEEMI--HRNNESPVPLIWTHLRS 1338 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +2 Query: 2 QKKLCAILPQWNLISEIST 58 QKKL AILPQWNLISEIS+ Sbjct: 1290 QKKLWAILPQWNLISEISS 1308 >gb|AEX98795.1| hypothetical chloroplast RF2-like protein (chloroplast) [Magnolia officinalis subsp. biloba] gi|372862734|gb|AEX98812.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia officinalis subsp. biloba] Length = 2298 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +3 Query: 60 KCLHYLILAEERILQNPNNESPVPFIWAYLRS 155 KCL L+L+EE I + NNESPVP IW +LRS Sbjct: 1309 KCLQNLLLSEEMI--HRNNESPVPLIWTHLRS 1338 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +2 Query: 2 QKKLCAILPQWNLISEIST 58 QKKL AILPQWNLISEIS+ Sbjct: 1290 QKKLWAILPQWNLISEISS 1308 >gb|AEX98728.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia officinalis subsp. biloba] Length = 2298 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +3 Query: 60 KCLHYLILAEERILQNPNNESPVPFIWAYLRS 155 KCL L+L+EE I + NNESPVP IW +LRS Sbjct: 1309 KCLQNLLLSEEMI--HRNNESPVPLIWTHLRS 1338 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +2 Query: 2 QKKLCAILPQWNLISEIST 58 QKKL AILPQWNLISEIS+ Sbjct: 1290 QKKLWAILPQWNLISEISS 1308 >gb|AEX98711.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia officinalis subsp. biloba] Length = 2298 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +3 Query: 60 KCLHYLILAEERILQNPNNESPVPFIWAYLRS 155 KCL L+L+EE I + NNESPVP IW +LRS Sbjct: 1309 KCLQNLLLSEEMI--HRNNESPVPLIWTHLRS 1338 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +2 Query: 2 QKKLCAILPQWNLISEIST 58 QKKL AILPQWNLISEIS+ Sbjct: 1290 QKKLWAILPQWNLISEISS 1308 >ref|YP_007474495.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia officinalis subsp. biloba] gi|452848831|ref|YP_007474512.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia officinalis subsp. biloba] gi|372862547|gb|AEX98627.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia officinalis subsp. biloba] gi|372862564|gb|AEX98644.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia officinalis subsp. biloba] Length = 2298 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +3 Query: 60 KCLHYLILAEERILQNPNNESPVPFIWAYLRS 155 KCL L+L+EE I + NNESPVP IW +LRS Sbjct: 1309 KCLQNLLLSEEMI--HRNNESPVPLIWTHLRS 1338 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +2 Query: 2 QKKLCAILPQWNLISEIST 58 QKKL AILPQWNLISEIS+ Sbjct: 1290 QKKLWAILPQWNLISEISS 1308 >ref|YP_007474412.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia officinalis] gi|452848746|ref|YP_007474428.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia officinalis] gi|570759881|ref|YP_008993305.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia dealbata] gi|570759900|ref|YP_008993324.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia dealbata] gi|619275778|ref|YP_009026924.1| hypothetical protein RF2 [Magnolia tripetala] gi|619275797|ref|YP_009026943.1| hypothetical protein RF2 [Magnolia tripetala] gi|372862463|gb|AEX98544.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia officinalis] gi|372862479|gb|AEX98560.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia officinalis] gi|608608446|gb|AHW52000.1| hypothetical protein RF2 [Magnolia tripetala] gi|608608465|gb|AHW52019.1| hypothetical protein RF2 [Magnolia tripetala] Length = 2298 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +3 Query: 60 KCLHYLILAEERILQNPNNESPVPFIWAYLRS 155 KCL L+L+EE I + NNESPVP IW +LRS Sbjct: 1309 KCLQNLLLSEEMI--HRNNESPVPLIWTHLRS 1338 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +2 Query: 2 QKKLCAILPQWNLISEIST 58 QKKL AILPQWNLISEIS+ Sbjct: 1290 QKKLWAILPQWNLISEISS 1308 >ref|YP_004769757.1| hypothetical chloroplast RF21 [Magnolia kwangsiensis] gi|342316266|ref|YP_004769774.1| hypothetical chloroplast RF21 [Magnolia kwangsiensis] gi|302424223|gb|ADL39099.1| hypothetical chloroplast RF21 [Magnolia kwangsiensis] gi|302424241|gb|ADL39117.1| hypothetical chloroplast RF21 [Magnolia kwangsiensis] Length = 2298 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +3 Query: 60 KCLHYLILAEERILQNPNNESPVPFIWAYLRS 155 KCL L+L+EE I + NNESPVP IW +LRS Sbjct: 1309 KCLQNLLLSEEMI--HRNNESPVPLIWTHLRS 1338 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +2 Query: 2 QKKLCAILPQWNLISEIST 58 QKKL AILPQWNLISEIS+ Sbjct: 1290 QKKLWAILPQWNLISEISS 1308 >ref|YP_740245.1| hypothetical chloroplast RF2 [Liriodendron tulipifera] gi|114107109|ref|YP_740264.1| hypothetical chloroplast RF2 [Liriodendron tulipifera] gi|122246286|sp|Q0G9F7.1|YCF2_LIRTU RecName: Full=Protein Ycf2 gi|113201037|gb|ABI32552.1| hypothetical chloroplast RF2 [Liriodendron tulipifera] gi|113201057|gb|ABI32572.1| hypothetical chloroplast RF2 [Liriodendron tulipifera] Length = 2292 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +3 Query: 60 KCLHYLILAEERILQNPNNESPVPFIWAYLRS 155 KCL L+L+EE I + NNESPVP IW +LRS Sbjct: 1308 KCLQNLLLSEEMI--HRNNESPVPLIWTHLRS 1337 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +2 Query: 2 QKKLCAILPQWNLISEIST 58 QKKL AILPQWNLISEIS+ Sbjct: 1289 QKKLWAILPQWNLISEISS 1307 >ref|NP_904142.1| Ycf2 [Amborella trichopoda] gi|34500977|ref|NP_904161.1| Ycf2 [Amborella trichopoda] gi|47117378|sp|P61241.1|YCF2_AMBTC RecName: Full=Protein Ycf2 gi|34481672|emb|CAD45149.1| Ycf2 protein [Amborella trichopoda] gi|34481692|emb|CAD45168.1| Ycf2 protein [Amborella trichopoda] Length = 2304 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +3 Query: 60 KCLHYLILAEERILQNPNNESPVPFIWAYLRS 155 KCL L+L+EE I + NNESPVP IW +LRS Sbjct: 1302 KCLQNLLLSEEMI--HRNNESPVPLIWTHLRS 1331 Score = 36.6 bits (83), Expect(2) = 1e-06 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +2 Query: 2 QKKLCAILPQWNLISEIST 58 QKKL AILPQWNLISEIS+ Sbjct: 1283 QKKLRAILPQWNLISEISS 1301 >ref|YP_001294228.1| hypothetical chloroplast RF2 [Buxus microphylla] gi|149390603|ref|YP_001294246.1| hypothetical chloroplast RF2 [Buxus microphylla] gi|205412818|sp|A6MM80.1|YCF2_BUXMI RecName: Full=Protein Ycf2 gi|146762328|gb|ABQ45292.1| hypothetical chloroplast RF2 [Buxus microphylla] gi|146762348|gb|ABQ45312.1| hypothetical chloroplast RF2 [Buxus microphylla] Length = 2281 Score = 45.8 bits (107), Expect(2) = 3e-06 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = +3 Query: 60 KCLHYLILAEERILQNPNNESPVPFIWAYLRS 155 KCLH L+L+EE I + NNESPVP IWA+LRS Sbjct: 1302 KCLHNLLLSEEMI--HRNNESPVPLIWAHLRS 1331 Score = 30.8 bits (68), Expect(2) = 3e-06 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 2 QKKLCAILPQWNLISEIST 58 QKK C LPQWNLISEIS+ Sbjct: 1285 QKKWC--LPQWNLISEISS 1301 >ref|YP_008993821.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia sinica] gi|570772258|ref|YP_008993840.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia sinica] Length = 2298 Score = 41.2 bits (95), Expect(2) = 4e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +3 Query: 60 KCLHYLILAEERILQNPNNESPVPFIWAYLRS 155 KCL L+L+EE I + NNESPVP IW +LRS Sbjct: 1309 KCLQNLLLSEEMI--HRNNESPVPLIWTHLRS 1338 Score = 35.0 bits (79), Expect(2) = 4e-06 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +2 Query: 2 QKKLCAILPQWNLISEIST 58 QKKL ILPQWNLISEIS+ Sbjct: 1290 QKKLWEILPQWNLISEISS 1308