BLASTX nr result
ID: Cocculus23_contig00024102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00024102 (226 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007205029.1| hypothetical protein PRUPE_ppa004026mg [Prun... 56 6e-06 >ref|XP_007205029.1| hypothetical protein PRUPE_ppa004026mg [Prunus persica] gi|462400671|gb|EMJ06228.1| hypothetical protein PRUPE_ppa004026mg [Prunus persica] Length = 535 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = +3 Query: 105 LASSDFLQMKDRGSRRNPTLICAPIMGESVEKMLFDMDKA 224 LASS LQ+ +G RR+ TLICAPIM ESV+KML DMDKA Sbjct: 9 LASSGGLQVGSKGVRRSSTLICAPIMAESVDKMLIDMDKA 48