BLASTX nr result
ID: Cocculus23_contig00023971
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00023971 (236 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007048063.1| ENTH/VHS family protein isoform 2 [Theobroma... 68 1e-09 ref|XP_007048062.1| ENTH/VHS family protein isoform 1 [Theobroma... 68 1e-09 emb|CBI21475.3| unnamed protein product [Vitis vinifera] 63 4e-08 ref|XP_002528993.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 ref|XP_007208477.1| hypothetical protein PRUPE_ppa004178mg [Prun... 61 1e-07 ref|XP_002276726.1| PREDICTED: regulation of nuclear pre-mRNA do... 61 1e-07 gb|EXB80860.1| hypothetical protein L484_020119 [Morus notabilis] 60 2e-07 ref|XP_006428118.1| hypothetical protein CICLE_v10027075mg [Citr... 57 2e-06 >ref|XP_007048063.1| ENTH/VHS family protein isoform 2 [Theobroma cacao] gi|508700324|gb|EOX92220.1| ENTH/VHS family protein isoform 2 [Theobroma cacao] Length = 405 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/39 (79%), Positives = 31/39 (79%) Frame = -1 Query: 146 TPLVQQQHSPLIQQPPAPPSFRPLQPPGMVYYAHPHQPH 30 TPL QQQ PL QQPP PPSFRPLQPPGMVYY HP PH Sbjct: 368 TPLTQQQLLPLTQQPPVPPSFRPLQPPGMVYYGHP--PH 404 >ref|XP_007048062.1| ENTH/VHS family protein isoform 1 [Theobroma cacao] gi|508700323|gb|EOX92219.1| ENTH/VHS family protein isoform 1 [Theobroma cacao] Length = 590 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/39 (79%), Positives = 31/39 (79%) Frame = -1 Query: 146 TPLVQQQHSPLIQQPPAPPSFRPLQPPGMVYYAHPHQPH 30 TPL QQQ PL QQPP PPSFRPLQPPGMVYY HP PH Sbjct: 553 TPLTQQQLLPLTQQPPVPPSFRPLQPPGMVYYGHP--PH 589 >emb|CBI21475.3| unnamed protein product [Vitis vinifera] Length = 473 Score = 63.2 bits (152), Expect = 4e-08 Identities = 33/62 (53%), Positives = 36/62 (58%) Frame = -1 Query: 224 YGYTNMLXXXXXXXXXXXXPHMMNLATPLVQQQHSPLIQQPPAPPSFRPLQPPGMVYYAH 45 YGY ++ HM+N PL QQQ PL QPPAPPSFRPLQ PGMVYY Sbjct: 411 YGYGSIPPLPPGPPPPPSTLHMVNPMAPLPQQQSIPL--QPPAPPSFRPLQLPGMVYYGL 468 Query: 44 PH 39 PH Sbjct: 469 PH 470 >ref|XP_002528993.1| conserved hypothetical protein [Ricinus communis] gi|223531583|gb|EEF33412.1| conserved hypothetical protein [Ricinus communis] Length = 514 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/38 (73%), Positives = 29/38 (76%) Frame = -1 Query: 143 PLVQQQHSPLIQQPPAPPSFRPLQPPGMVYYAHPHQPH 30 P+ QQQ PL QQ P PPSFRPLQPPGMVYY HP PH Sbjct: 478 PIPQQQPMPLTQQAPGPPSFRPLQPPGMVYYGHP--PH 513 >ref|XP_007208477.1| hypothetical protein PRUPE_ppa004178mg [Prunus persica] gi|462404119|gb|EMJ09676.1| hypothetical protein PRUPE_ppa004178mg [Prunus persica] Length = 525 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/41 (70%), Positives = 30/41 (73%) Frame = -1 Query: 161 MMNLATPLVQQQHSPLIQQPPAPPSFRPLQPPGMVYYAHPH 39 M A + QQQ PL QQPPAP SFRPLQPPGMVYY HPH Sbjct: 483 MNQQAVQITQQQPIPLTQQPPAP-SFRPLQPPGMVYYGHPH 522 >ref|XP_002276726.1| PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 2-like [Vitis vinifera] Length = 524 Score = 61.2 bits (147), Expect = 1e-07 Identities = 34/77 (44%), Positives = 38/77 (49%), Gaps = 15/77 (19%) Frame = -1 Query: 224 YGYTNMLXXXXXXXXXXXXPHMMNLATPLVQQQHSPLIQQP---------------PAPP 90 YGY ++ HM+N PL QQQ PL+QQP PAPP Sbjct: 445 YGYGSIPPLPPGPPPPPSTLHMVNPMAPLPQQQSIPLVQQPALLTRHQPMPLTQQPPAPP 504 Query: 89 SFRPLQPPGMVYYAHPH 39 SFRPLQ PGMVYY PH Sbjct: 505 SFRPLQLPGMVYYGLPH 521 >gb|EXB80860.1| hypothetical protein L484_020119 [Morus notabilis] Length = 524 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -1 Query: 143 PLVQQQHSPLIQQPPAPPSFRPLQPPGMVYYAHP 42 P+ QQQ PL QQPP PSFRPLQPPG+VYY HP Sbjct: 487 PIAQQQTMPLTQQPPIAPSFRPLQPPGIVYYGHP 520 >ref|XP_006428118.1| hypothetical protein CICLE_v10027075mg [Citrus clementina] gi|568819514|ref|XP_006464295.1| PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1B-like [Citrus sinensis] gi|557530108|gb|ESR41358.1| hypothetical protein CICLE_v10027075mg [Citrus clementina] Length = 525 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/59 (50%), Positives = 33/59 (55%), Gaps = 14/59 (23%) Frame = -1 Query: 164 HMMNLATPLVQQQHSPLIQQP--------------PAPPSFRPLQPPGMVYYAHPHQPH 30 HM++ PL QQQ PL QQP P PPSFRPLQPPGMV+Y P PH Sbjct: 468 HMVSPMVPLTQQQQLPLAQQPAPSNQQLTMLTQQPPGPPSFRPLQPPGMVFYGQP--PH 524