BLASTX nr result
ID: Cocculus23_contig00023938
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00023938 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADR70882.1| respiratory burst oxidase D [Manihot esculenta] 61 2e-07 ref|XP_002303736.2| hypothetical protein POPTR_0003s15810g [Popu... 59 9e-07 ref|XP_002318793.2| respiratory burst oxidase C family protein [... 57 3e-06 ref|XP_002322314.2| respiratory burst oxidase C family protein [... 57 3e-06 ref|XP_007017524.1| Respiratory burst oxidase D [Theobroma cacao... 57 3e-06 ref|XP_004299201.1| PREDICTED: respiratory burst oxidase homolog... 57 3e-06 emb|CBI29288.3| unnamed protein product [Vitis vinifera] 55 8e-06 ref|XP_002268604.1| PREDICTED: respiratory burst oxidase homolog... 55 8e-06 >gb|ADR70882.1| respiratory burst oxidase D [Manihot esculenta] Length = 914 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +1 Query: 217 NGCAGVFYCGAPALTKELRQLALDFSRRTSTK 312 NG GVFYCGAPALTKELRQLALDFS RTSTK Sbjct: 875 NGRIGVFYCGAPALTKELRQLALDFSHRTSTK 906 >ref|XP_002303736.2| hypothetical protein POPTR_0003s15810g [Populus trichocarpa] gi|550343272|gb|EEE78715.2| hypothetical protein POPTR_0003s15810g [Populus trichocarpa] Length = 926 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +1 Query: 229 GVFYCGAPALTKELRQLALDFSRRTSTK 312 GVFYCGAPALTKELRQLALDFSR+TSTK Sbjct: 891 GVFYCGAPALTKELRQLALDFSRKTSTK 918 >ref|XP_002318793.2| respiratory burst oxidase C family protein [Populus trichocarpa] gi|550326872|gb|EEE97013.2| respiratory burst oxidase C family protein [Populus trichocarpa] Length = 909 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 229 GVFYCGAPALTKELRQLALDFSRRTSTK 312 GVFYCGAPALTKELRQLALDFS +TSTK Sbjct: 874 GVFYCGAPALTKELRQLALDFSHKTSTK 901 >ref|XP_002322314.2| respiratory burst oxidase C family protein [Populus trichocarpa] gi|550322544|gb|EEF06441.2| respiratory burst oxidase C family protein [Populus trichocarpa] Length = 915 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 229 GVFYCGAPALTKELRQLALDFSRRTSTK 312 GVFYCGAPALTKELRQLALDFS +TSTK Sbjct: 880 GVFYCGAPALTKELRQLALDFSHKTSTK 907 >ref|XP_007017524.1| Respiratory burst oxidase D [Theobroma cacao] gi|508722852|gb|EOY14749.1| Respiratory burst oxidase D [Theobroma cacao] Length = 961 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 229 GVFYCGAPALTKELRQLALDFSRRTSTK 312 GVFYCGAPALTKELRQLALDFS +TSTK Sbjct: 926 GVFYCGAPALTKELRQLALDFSHKTSTK 953 >ref|XP_004299201.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Fragaria vesca subsp. vesca] Length = 935 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 229 GVFYCGAPALTKELRQLALDFSRRTSTK 312 GVFYCGAPALTKEL+QLALDFS RTSTK Sbjct: 900 GVFYCGAPALTKELKQLALDFSHRTSTK 927 >emb|CBI29288.3| unnamed protein product [Vitis vinifera] Length = 827 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 229 GVFYCGAPALTKELRQLALDFSRRTSTK 312 GVFYCGAPALTK+LRQLALDFS RT+TK Sbjct: 792 GVFYCGAPALTKDLRQLALDFSHRTTTK 819 >ref|XP_002268604.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Vitis vinifera] Length = 923 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 229 GVFYCGAPALTKELRQLALDFSRRTSTK 312 GVFYCGAPALTK+LRQLALDFS RT+TK Sbjct: 888 GVFYCGAPALTKDLRQLALDFSHRTTTK 915