BLASTX nr result
ID: Cocculus23_contig00023770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00023770 (605 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC93463.1| hypothetical protein BAUCODRAFT_241156 [Baudoinia... 72 9e-11 gb|EME44341.1| hypothetical protein DOTSEDRAFT_44591 [Dothistrom... 67 4e-09 gb|EMF13692.1| acyl-CoA synthetase [Sphaerulina musiva SO2202] 65 1e-08 gb|EON68243.1| long-chain fatty-acid-CoA ligase [Coniosporium ap... 65 1e-08 gb|EME79022.1| hypothetical protein MYCFIDRAFT_198907 [Pseudocer... 62 1e-07 ref|XP_003852465.1| hypothetical protein MYCGRDRAFT_86257 [Zymos... 60 5e-07 >gb|EMC93463.1| hypothetical protein BAUCODRAFT_241156 [Baudoinia compniacensis UAMH 10762] Length = 742 Score = 72.4 bits (176), Expect = 9e-11 Identities = 33/63 (52%), Positives = 44/63 (69%) Frame = -3 Query: 189 FGAGNMADIYSRKDLKTFTPQPKIYRGGPYNVPVPGAVKKEGETVIYRNAKSKDALQNTP 10 + + NM DI +R+DLK+ PQPK+Y+ PY V VPGA K EGETV RN ++ + L+NTP Sbjct: 22 YNSDNMGDIMARQDLKSMVPQPKVYKRPPYTVEVPGAKKVEGETVTRRNHRTVNELKNTP 81 Query: 9 GDD 1 D Sbjct: 82 DPD 84 >gb|EME44341.1| hypothetical protein DOTSEDRAFT_44591 [Dothistroma septosporum NZE10] Length = 716 Score = 67.0 bits (162), Expect = 4e-09 Identities = 31/58 (53%), Positives = 39/58 (67%) Frame = -3 Query: 174 MADIYSRKDLKTFTPQPKIYRGGPYNVPVPGAVKKEGETVIYRNAKSKDALQNTPGDD 1 M D+ RKDLKT PQPK Y+ P+ V VPGA K++GET RN + KD L++TP D Sbjct: 1 MGDVMGRKDLKTLVPQPKNYKRPPFTVEVPGAQKQDGETAPRRNIRCKDELKSTPQPD 58 >gb|EMF13692.1| acyl-CoA synthetase [Sphaerulina musiva SO2202] Length = 719 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/57 (52%), Positives = 38/57 (66%) Frame = -3 Query: 171 ADIYSRKDLKTFTPQPKIYRGGPYNVPVPGAVKKEGETVIYRNAKSKDALQNTPGDD 1 A I +RKDLKT PQPK+Y+ P+ PG K +GETV RN ++KD L+NTP D Sbjct: 6 AGIMARKDLKTLVPQPKMYKKPPFTAEAPGVQKVDGETVPRRNIRTKDQLKNTPNPD 62 >gb|EON68243.1| long-chain fatty-acid-CoA ligase [Coniosporium apollinis CBS 100218] Length = 700 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/51 (60%), Positives = 36/51 (70%) Frame = -3 Query: 153 KDLKTFTPQPKIYRGGPYNVPVPGAVKKEGETVIYRNAKSKDALQNTPGDD 1 KDLK FTPQPK Y+ PY V VPGA K +GET+ RN K+KD L+ P DD Sbjct: 3 KDLKHFTPQPKSYKTPPYTVEVPGATKVKGETIPRRNIKTKDGLKLRPRDD 53 >gb|EME79022.1| hypothetical protein MYCFIDRAFT_198907 [Pseudocercospora fijiensis CIRAD86] Length = 714 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/55 (50%), Positives = 37/55 (67%) Frame = -3 Query: 174 MADIYSRKDLKTFTPQPKIYRGGPYNVPVPGAVKKEGETVIYRNAKSKDALQNTP 10 M D+ SRKDLK PQP++Y+ P+ V V G K +GET+ RN K+KD L+ TP Sbjct: 1 MGDVMSRKDLKQMLPQPRMYKKPPFTVEVAGVKKVDGETIPRRNVKTKDELKTTP 55 >ref|XP_003852465.1| hypothetical protein MYCGRDRAFT_86257 [Zymoseptoria tritici IPO323] gi|339472346|gb|EGP87441.1| hypothetical protein MYCGRDRAFT_86257 [Zymoseptoria tritici IPO323] Length = 711 Score = 60.1 bits (144), Expect = 5e-07 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = -3 Query: 159 SRKDLKTFTPQPKIYRGGPYNVPVPGAVKKEGETVIYRNAKSKDALQNTP 10 +RKDLK+ PQP++Y+ P+ + VPG K EGET+ RN K+KD L TP Sbjct: 2 ARKDLKSLVPQPRLYKKPPFTIEVPGLEKVEGETIPRRNVKAKDGLFETP 51