BLASTX nr result
ID: Cocculus23_contig00023766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00023766 (840 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79019.1| hypothetical protein VITISV_043767 [Vitis vinifera] 45 5e-07 ref|YP_009000364.1| petD protein (chloroplast) [Arabis alpina] g... 58 5e-06 ref|XP_006289551.1| hypothetical protein CARUB_v10003096mg, part... 58 5e-06 emb|CAN60722.1| hypothetical protein VITISV_022058 [Vitis vinifera] 39 9e-06 emb|CAN66445.1| hypothetical protein VITISV_003574 [Vitis vinifera] 42 9e-06 >emb|CAN79019.1| hypothetical protein VITISV_043767 [Vitis vinifera] Length = 1070 Score = 44.7 bits (104), Expect(2) = 5e-07 Identities = 21/54 (38%), Positives = 32/54 (59%) Frame = +2 Query: 551 FMTLSLQCCPLCMRSEESADHLFCTCHFSVMIWNKWRDISRDKIRKPSSIELLL 712 + TLS C LCM+ ESADHLF C+ ++ +W++ I++ P SI L+ Sbjct: 930 YKTLSPNICKLCMKHGESADHLFLRCYLTMGLWHRLFQIAKMDWVPPRSISDLI 983 Score = 36.2 bits (82), Expect(2) = 5e-07 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 5/53 (9%) Frame = +1 Query: 697 YRAFVKKTGFVIL-----CAII*SLWLERNERIFEDTIEDWDGVWDSSQTLAA 840 Y+ F K ++L A+I +W ERN RIF+D + + + +WD+ LA+ Sbjct: 987 YKGFGKSKRSIVLWQTACIALIWVVWRERNARIFKDKVRNSENLWDTIHFLAS 1039 >ref|YP_009000364.1| petD protein (chloroplast) [Arabis alpina] gi|571025836|emb|CCW28211.1| petD protein (chloroplast) [Arabis alpina] Length = 174 Score = 57.8 bits (138), Expect = 5e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +2 Query: 428 MSGSLGGWIHKNSPIPITKKPYLNDPL 508 MSGSLGGWIHKNSPIPITKKP LNDP+ Sbjct: 1 MSGSLGGWIHKNSPIPITKKPDLNDPV 27 >ref|XP_006289551.1| hypothetical protein CARUB_v10003096mg, partial [Capsella rubella] gi|482558257|gb|EOA22449.1| hypothetical protein CARUB_v10003096mg, partial [Capsella rubella] Length = 76 Score = 57.8 bits (138), Expect = 5e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +2 Query: 428 MSGSLGGWIHKNSPIPITKKPYLNDPL 508 MSGSLGGWIHKNSPIPITKKP LNDP+ Sbjct: 1 MSGSLGGWIHKNSPIPITKKPDLNDPV 27 >emb|CAN60722.1| hypothetical protein VITISV_022058 [Vitis vinifera] Length = 1291 Score = 39.3 bits (90), Expect(2) = 9e-06 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +2 Query: 560 LSLQCCPLCMRSEESADHLFCTCHFSVMIWNKWRDISRDKIRKPSSI 700 ++L C LCM ESADHLF C ++ +W++ +++ P SI Sbjct: 1151 INLDICKLCMEQGESADHLFLHCSVTLGLWHRLFQLAKMDWVPPKSI 1197 Score = 37.4 bits (85), Expect(2) = 9e-06 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 5/53 (9%) Frame = +1 Query: 697 YRAFVKKTGFVIL-----CAII*SLWLERNERIFEDTIEDWDGVWDSSQTLAA 840 Y+ F K VIL A+I +W ERN RIFED + + +WDS LA+ Sbjct: 1205 YKGFGKSKRGVILWQNASIALIWVVWQERNVRIFEDKTRNSENLWDSIHFLAS 1257 >emb|CAN66445.1| hypothetical protein VITISV_003574 [Vitis vinifera] Length = 1290 Score = 41.6 bits (96), Expect(2) = 9e-06 Identities = 17/50 (34%), Positives = 29/50 (58%) Frame = +2 Query: 551 FMTLSLQCCPLCMRSEESADHLFCTCHFSVMIWNKWRDISRDKIRKPSSI 700 + LS C LCM+ ESADH+F C ++ +W++ +++ + P SI Sbjct: 644 YKALSPDICILCMKHGESADHIFLHCSLTIRLWHRLFQLAKMDLVPPRSI 693 Score = 35.0 bits (79), Expect(2) = 9e-06 Identities = 16/34 (47%), Positives = 23/34 (67%) Frame = +1 Query: 739 AII*SLWLERNERIFEDTIEDWDGVWDSSQTLAA 840 A+I +W ERN RIFED + + + +WDS LA+ Sbjct: 720 ALIRVVWWERNARIFEDKVRNSEYLWDSIVFLAS 753