BLASTX nr result
ID: Cocculus23_contig00023651
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00023651 (266 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006596850.1| PREDICTED: uncharacterized protein LOC102669... 71 2e-10 ref|XP_006590081.1| PREDICTED: uncharacterized protein LOC102666... 71 2e-10 ref|XP_006590044.1| PREDICTED: uncharacterized protein LOC102665... 71 2e-10 ref|XP_006583762.1| PREDICTED: uncharacterized protein LOC102665... 71 2e-10 ref|XP_006576593.1| PREDICTED: uncharacterized protein LOC102667... 71 2e-10 ref|XP_006588127.1| PREDICTED: uncharacterized protein LOC102669... 70 2e-10 emb|CAA69271.1| lectin receptor kinase [Arabidopsis thaliana] 70 4e-10 ref|XP_006593143.1| PREDICTED: uncharacterized protein LOC102660... 69 5e-10 ref|XP_006592464.1| PREDICTED: uncharacterized protein LOC102665... 69 5e-10 ref|NP_175304.1| uncharacterized protein [Arabidopsis thaliana] ... 69 7e-10 gb|AAG60117.1|AC073555_1 copia-type polyprotein, putative [Arabi... 69 7e-10 gb|AAG50698.1|AC079604_5 copia-type polyprotein, putative [Arabi... 69 7e-10 gb|ABK28142.1| unknown [Arabidopsis thaliana] 69 7e-10 emb|CAB71063.1| copia-type polyprotein [Arabidopsis thaliana] 69 7e-10 emb|CAB75469.1| copia-type reverse transcriptase-like protein [A... 69 7e-10 gb|AAD50001.1|AC007259_14 Hypothetical protein [Arabidopsis thal... 69 7e-10 gb|AAG60131.1|AC073555_15 lectin receptor kinase, putative [Arab... 69 9e-10 gb|AAF16534.1|AC013482_8 T26F17.17 [Arabidopsis thaliana] 69 9e-10 ref|XP_006590177.1| PREDICTED: uncharacterized protein LOC102669... 68 2e-09 ref|XP_006584344.1| PREDICTED: uncharacterized protein LOC102662... 68 2e-09 >ref|XP_006596850.1| PREDICTED: uncharacterized protein LOC102669510 [Glycine max] Length = 296 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/51 (66%), Positives = 42/51 (82%) Frame = -3 Query: 153 MSNSGLVPFEVPMLNKSNYDNWSIKTKALLGAQDVWEPVETGYNKPQDEAA 1 M+N G PF++PML K+NYDNWSIK KALLGAQDVW+ VE G+ + QDEA+ Sbjct: 1 MANGGF-PFQMPMLTKNNYDNWSIKMKALLGAQDVWDIVENGFEE-QDEAS 49 >ref|XP_006590081.1| PREDICTED: uncharacterized protein LOC102666085 [Glycine max] Length = 296 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/51 (66%), Positives = 42/51 (82%) Frame = -3 Query: 153 MSNSGLVPFEVPMLNKSNYDNWSIKTKALLGAQDVWEPVETGYNKPQDEAA 1 M+N G PF++PML K+NYDNWSIK KALLGAQDVW+ VE G+ + QDEA+ Sbjct: 1 MANGGF-PFQMPMLTKNNYDNWSIKMKALLGAQDVWDIVENGFEE-QDEAS 49 >ref|XP_006590044.1| PREDICTED: uncharacterized protein LOC102665857 [Glycine max] Length = 678 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/51 (66%), Positives = 42/51 (82%) Frame = -3 Query: 153 MSNSGLVPFEVPMLNKSNYDNWSIKTKALLGAQDVWEPVETGYNKPQDEAA 1 M+N G PF++PML K+NYDNWSIK KALLGAQDVW+ VE G+ + QDEA+ Sbjct: 1 MANGGF-PFQMPMLTKNNYDNWSIKMKALLGAQDVWDIVENGFEE-QDEAS 49 >ref|XP_006583762.1| PREDICTED: uncharacterized protein LOC102665045, partial [Glycine max] Length = 163 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/51 (66%), Positives = 42/51 (82%) Frame = -3 Query: 153 MSNSGLVPFEVPMLNKSNYDNWSIKTKALLGAQDVWEPVETGYNKPQDEAA 1 M+N G PF++PML K+NYDNWSIK KALLGAQDVW+ VE G+ + QDEA+ Sbjct: 1 MANGGF-PFQMPMLTKNNYDNWSIKMKALLGAQDVWDIVENGFEE-QDEAS 49 >ref|XP_006576593.1| PREDICTED: uncharacterized protein LOC102667150 [Glycine max] Length = 93 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/51 (66%), Positives = 42/51 (82%) Frame = -3 Query: 153 MSNSGLVPFEVPMLNKSNYDNWSIKTKALLGAQDVWEPVETGYNKPQDEAA 1 M+N G PF++PML K+NYDNWSIK KALLGAQDVW+ VE G+ + QDEA+ Sbjct: 1 MANGGF-PFQMPMLTKNNYDNWSIKMKALLGAQDVWDIVENGFEE-QDEAS 49 >ref|XP_006588127.1| PREDICTED: uncharacterized protein LOC102669122 [Glycine max] Length = 277 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/51 (64%), Positives = 42/51 (82%) Frame = -3 Query: 153 MSNSGLVPFEVPMLNKSNYDNWSIKTKALLGAQDVWEPVETGYNKPQDEAA 1 M+N G PF++PML K+NYDNWSIK KALLGAQDVW+ +E G+ + QDEA+ Sbjct: 1 MANGGF-PFQMPMLTKNNYDNWSIKMKALLGAQDVWDIIENGFEE-QDEAS 49 >emb|CAA69271.1| lectin receptor kinase [Arabidopsis thaliana] Length = 544 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/57 (54%), Positives = 42/57 (73%) Frame = -3 Query: 171 RSSSIAMSNSGLVPFEVPMLNKSNYDNWSIKTKALLGAQDVWEPVETGYNKPQDEAA 1 +S I S VPF+VP+L KSNYDNWS++ KA+LGA DVWE VE G+ +P++E + Sbjct: 10 QSLKILKMASNNVPFQVPVLTKSNYDNWSLRMKAILGAHDVWEIVEKGFIEPENEGS 66 >ref|XP_006593143.1| PREDICTED: uncharacterized protein LOC102660881 [Glycine max] Length = 114 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/51 (58%), Positives = 37/51 (72%) Frame = -3 Query: 153 MSNSGLVPFEVPMLNKSNYDNWSIKTKALLGAQDVWEPVETGYNKPQDEAA 1 M+++G+ F VP+L YDNWSIK KA LGA DVWE VE GY +PQDE + Sbjct: 1 MASNGVASFHVPLLKGITYDNWSIKIKAFLGAHDVWEMVEKGYKEPQDETS 51 >ref|XP_006592464.1| PREDICTED: uncharacterized protein LOC102665448 [Glycine max] Length = 119 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = -3 Query: 153 MSNSGLVPFEVPMLNKSNYDNWSIKTKALLGAQDVWEPVETGYNKPQDEAA 1 M+N G PF++PML K+NYDNWSIK KALLGAQDVW+ VE G+ + QDE + Sbjct: 1 MANGGF-PFQMPMLTKNNYDNWSIKMKALLGAQDVWDIVENGFEE-QDEVS 49 >ref|NP_175304.1| uncharacterized protein [Arabidopsis thaliana] gi|51968950|dbj|BAD43167.1| copia-type reverse transcriptase-like protein [Arabidopsis thaliana] gi|88900318|gb|ABD57471.1| At1g48720 [Arabidopsis thaliana] gi|91805343|gb|ABE65401.1| hypothetical protein At1g48720 [Arabidopsis thaliana] gi|110739223|dbj|BAF01526.1| hypothetical protein [Arabidopsis thaliana] gi|332194218|gb|AEE32339.1| uncharacterized protein AT1G48720 [Arabidopsis thaliana] Length = 97 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = -3 Query: 144 SGLVPFEVPMLNKSNYDNWSIKTKALLGAQDVWEPVETGYNKPQDEAA 1 S VPF+VP+L KSNYDNWS++ KA+LGA DVWE VE G+ +P++E + Sbjct: 3 SNNVPFQVPVLTKSNYDNWSLRMKAILGAHDVWEIVEKGFIEPENEGS 50 >gb|AAG60117.1|AC073555_1 copia-type polyprotein, putative [Arabidopsis thaliana] Length = 1352 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = -3 Query: 144 SGLVPFEVPMLNKSNYDNWSIKTKALLGAQDVWEPVETGYNKPQDEAA 1 S VPF+VP+L KSNYDNWS++ KA+LGA DVWE VE G+ +P++E + Sbjct: 3 SNNVPFQVPVLTKSNYDNWSLRMKAILGAHDVWEIVEKGFIEPENEGS 50 >gb|AAG50698.1|AC079604_5 copia-type polyprotein, putative [Arabidopsis thaliana] gi|12321387|gb|AAG50765.1|AC079131_10 copia-type polyprotein, putative [Arabidopsis thaliana] Length = 1320 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = -3 Query: 144 SGLVPFEVPMLNKSNYDNWSIKTKALLGAQDVWEPVETGYNKPQDEAA 1 S VPF+VP+L KSNYDNWS++ KA+LGA DVWE VE G+ +P++E + Sbjct: 3 SNNVPFQVPVLTKSNYDNWSLRMKAILGAHDVWEIVEKGFIEPENEGS 50 >gb|ABK28142.1| unknown [Arabidopsis thaliana] Length = 98 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = -3 Query: 144 SGLVPFEVPMLNKSNYDNWSIKTKALLGAQDVWEPVETGYNKPQDEAA 1 S VPF+VP+L KSNYDNWS++ KA+LGA DVWE VE G+ +P++E + Sbjct: 3 SNNVPFQVPVLTKSNYDNWSLRMKAILGAHDVWEIVEKGFIEPENEGS 50 >emb|CAB71063.1| copia-type polyprotein [Arabidopsis thaliana] Length = 1352 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = -3 Query: 144 SGLVPFEVPMLNKSNYDNWSIKTKALLGAQDVWEPVETGYNKPQDEAA 1 S VPF+VP+L KSNYDNWS++ KA+LGA DVWE VE G+ +P++E + Sbjct: 3 SNNVPFQVPVLTKSNYDNWSLRMKAILGAHDVWEIVEKGFIEPENEGS 50 >emb|CAB75469.1| copia-type reverse transcriptase-like protein [Arabidopsis thaliana] Length = 1272 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = -3 Query: 144 SGLVPFEVPMLNKSNYDNWSIKTKALLGAQDVWEPVETGYNKPQDEAA 1 S VPF+VP+L KSNYDNWS++ KA+LGA DVWE VE G+ +P++E + Sbjct: 3 SNNVPFQVPVLTKSNYDNWSLRMKAILGAHDVWEIVEKGFIEPENEGS 50 >gb|AAD50001.1|AC007259_14 Hypothetical protein [Arabidopsis thaliana] Length = 1352 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = -3 Query: 144 SGLVPFEVPMLNKSNYDNWSIKTKALLGAQDVWEPVETGYNKPQDEAA 1 S VPF+VP+L KSNYDNWS++ KA+LGA DVWE VE G+ +P++E + Sbjct: 3 SNNVPFQVPVLTKSNYDNWSLRMKAILGAHDVWEIVEKGFIEPENEGS 50 >gb|AAG60131.1|AC073555_15 lectin receptor kinase, putative [Arabidopsis thaliana] Length = 70 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = -3 Query: 144 SGLVPFEVPMLNKSNYDNWSIKTKALLGAQDVWEPVETGYNKPQDE 7 S VPF+VP+L KSNYDNWS++ KA+LGA DVWE VE G+ +P++E Sbjct: 3 SNNVPFQVPVLTKSNYDNWSLRMKAILGAHDVWEIVEKGFIEPENE 48 >gb|AAF16534.1|AC013482_8 T26F17.17 [Arabidopsis thaliana] Length = 1291 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = -3 Query: 144 SGLVPFEVPMLNKSNYDNWSIKTKALLGAQDVWEPVETGYNKPQDEAA 1 S VPF+VP+L KSNYDNWS++ KA+LGA DVWE VE G+ +P++E + Sbjct: 3 SNNVPFQVPVLTKSNYDNWSLQMKAILGAHDVWEIVEKGFIEPENEGS 50 >ref|XP_006590177.1| PREDICTED: uncharacterized protein LOC102669657 [Glycine max] Length = 711 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = -3 Query: 153 MSNSGLVPFEVPMLNKSNYDNWSIKTKALLGAQDVWEPVETGYNKPQDEAA 1 M+N G PF++ ML K+NYDNWSIK KALLGAQDVW+ VE G+ + QDEA+ Sbjct: 1 MANGGF-PFQMSMLTKNNYDNWSIKIKALLGAQDVWDIVENGFEE-QDEAS 49 >ref|XP_006584344.1| PREDICTED: uncharacterized protein LOC102662068 [Glycine max] Length = 236 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = -3 Query: 153 MSNSGLVPFEVPMLNKSNYDNWSIKTKALLGAQDVWEPVETGYNKPQDEA 4 M+N G PF++PML K+NYDNWSIK KALLGAQDVW+ VE + + QDEA Sbjct: 1 MANGGF-PFQMPMLTKNNYDNWSIKMKALLGAQDVWDIVENDFEE-QDEA 48