BLASTX nr result
ID: Cocculus23_contig00023622
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00023622 (431 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|E3W9M3.1|AA7GT_DELGR RecName: Full=Cyanidin 3-O-glucoside 7-O... 57 3e-06 >sp|E3W9M3.1|AA7GT_DELGR RecName: Full=Cyanidin 3-O-glucoside 7-O-glucosyltransferase (acyl-glucose); Short=AA7GT; Short=Dg AA7GT; AltName: Full=Acyl-glucose-dependent anthocyanin 7-O-glucosytransferase; AltName: Full=Beta-glucosidase like protein; Short=DgBGLUL; Flags: Precursor gi|312147036|dbj|BAJ33502.1| beta glucosidase like protein [Delphinium grandiflorum] Length = 505 Score = 56.6 bits (135), Expect = 3e-06 Identities = 33/75 (44%), Positives = 40/75 (53%) Frame = +2 Query: 35 NPSGLQKLLEYFKDHYGNPPVYVQENGLSSSSFTYLHNDTFQKDLDNPH*MCFAGRISPA 214 +PSGL+ LL YFKD+YGNPPVYV ENG S N+T D+ GRI Sbjct: 379 DPSGLKNLLRYFKDNYGNPPVYVHENGFGSP-----QNETLDDDM---------GRIRYI 424 Query: 215 SSSLAIGLSQLKYGS 259 S + L +K GS Sbjct: 425 SGYIGSMLEAIKNGS 439