BLASTX nr result
ID: Cocculus23_contig00023601
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00023601 (468 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007013201.1| Uncharacterized protein TCM_037899 [Theobrom... 63 4e-08 gb|EYU24693.1| hypothetical protein MIMGU_mgv1a018247mg [Mimulus... 62 6e-08 ref|XP_006451138.1| hypothetical protein CICLE_v10010038mg [Citr... 62 6e-08 ref|XP_006356160.1| PREDICTED: uncharacterized protein LOC102579... 60 2e-07 ref|XP_007152821.1| hypothetical protein PHAVU_004G162600g [Phas... 60 3e-07 ref|XP_002324414.1| hypothetical protein POPTR_0018s05880g [Popu... 59 9e-07 ref|XP_006381709.1| hypothetical protein POPTR_0006s16210g [Popu... 58 1e-06 ref|XP_002514322.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >ref|XP_007013201.1| Uncharacterized protein TCM_037899 [Theobroma cacao] gi|508783564|gb|EOY30820.1| Uncharacterized protein TCM_037899 [Theobroma cacao] Length = 84 Score = 63.2 bits (152), Expect = 4e-08 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -2 Query: 230 QQCLCSPTQHPGSFRCRHHHGEYQWRGRLRAK 135 +QCLCSPT+HPGSFRCRHHH EY W GR +K Sbjct: 52 KQCLCSPTKHPGSFRCRHHHAEYVWGGRFISK 83 >gb|EYU24693.1| hypothetical protein MIMGU_mgv1a018247mg [Mimulus guttatus] Length = 88 Score = 62.4 bits (150), Expect = 6e-08 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -2 Query: 224 CLCSPTQHPGSFRCRHHHGEYQWRGRLRAK 135 C+CSPT HPGSFRCRHHHGEYQW RL K Sbjct: 57 CVCSPTGHPGSFRCRHHHGEYQWVNRLGTK 86 >ref|XP_006451138.1| hypothetical protein CICLE_v10010038mg [Citrus clementina] gi|557554364|gb|ESR64378.1| hypothetical protein CICLE_v10010038mg [Citrus clementina] Length = 91 Score = 62.4 bits (150), Expect = 6e-08 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -2 Query: 230 QQCLCSPTQHPGSFRCRHHHGEYQWRGRL 144 +QC+CSPT HPGSFRCRHHH +Y WRGR+ Sbjct: 53 KQCVCSPTTHPGSFRCRHHHAQYVWRGRI 81 >ref|XP_006356160.1| PREDICTED: uncharacterized protein LOC102579994 [Solanum tuberosum] Length = 77 Score = 60.5 bits (145), Expect = 2e-07 Identities = 21/29 (72%), Positives = 26/29 (89%) Frame = -2 Query: 230 QQCLCSPTQHPGSFRCRHHHGEYQWRGRL 144 +QC+CSPTQHPGSFRCRHHH +Y+W +L Sbjct: 41 KQCVCSPTQHPGSFRCRHHHADYKWAAQL 69 >ref|XP_007152821.1| hypothetical protein PHAVU_004G162600g [Phaseolus vulgaris] gi|561026130|gb|ESW24815.1| hypothetical protein PHAVU_004G162600g [Phaseolus vulgaris] Length = 72 Score = 60.1 bits (144), Expect = 3e-07 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -2 Query: 230 QQCLCSPTQHPGSFRCRHHHGEYQWRGR 147 ++C+CSP+QHPGSFRCR HHGEY WRGR Sbjct: 42 KRCVCSPSQHPGSFRCRLHHGEYVWRGR 69 >ref|XP_002324414.1| hypothetical protein POPTR_0018s05880g [Populus trichocarpa] gi|222865848|gb|EEF02979.1| hypothetical protein POPTR_0018s05880g [Populus trichocarpa] Length = 85 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/35 (65%), Positives = 28/35 (80%), Gaps = 1/35 (2%) Frame = -2 Query: 230 QQCLCSPTQHPGSFRCRHHHGEYQWRGRL-RAKHP 129 ++CLCSPT+HPGSFRCRHH +Y W GR+ R K P Sbjct: 50 KKCLCSPTRHPGSFRCRHHRSDYVWGGRITRRKQP 84 >ref|XP_006381709.1| hypothetical protein POPTR_0006s16210g [Populus trichocarpa] gi|550336460|gb|ERP59506.1| hypothetical protein POPTR_0006s16210g [Populus trichocarpa] Length = 88 Score = 58.2 bits (139), Expect = 1e-06 Identities = 21/31 (67%), Positives = 25/31 (80%) Frame = -2 Query: 227 QCLCSPTQHPGSFRCRHHHGEYQWRGRLRAK 135 +CLCSPT+HPGSFRCRHH +Y W GR+ K Sbjct: 51 KCLCSPTRHPGSFRCRHHRSDYVWSGRITRK 81 >ref|XP_002514322.1| conserved hypothetical protein [Ricinus communis] gi|223546778|gb|EEF48276.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = -2 Query: 230 QQCLCSPTQHPGSFRCRHHHGEYQWRGRLRAK 135 + C+CSPT+HPGSFRCRHHH +Y W R+ K Sbjct: 59 KMCVCSPTRHPGSFRCRHHHVDYAWGRRITKK 90